Recombinant ATP synthase protein I, sodium ion specific (atpI)

Shipped with Ice Packs
In Stock

Description

Introduction

ATP synthase, or F0F1-ATPase, is an enzyme that catalyzes the synthesis of ATP from ADP and inorganic phosphate (Pi) using an electrochemical ion gradient . It can also work in reverse, hydrolyzing ATP to create an ion gradient across a membrane . ATP synthases are found in bacteria, archaea, mitochondria, and chloroplasts, highlighting their importance in energy conservation in living organisms .

General Structure and Function of ATP Synthase

ATP synthase consists of two main parts: F1 and F0 . The F1 component is a peripheral membrane protein complex that contains the catalytic sites for ATP synthesis and hydrolysis . The F0 component is an integral membrane protein complex that serves as an ion channel, allowing protons (H+) or sodium ions (Na+) to flow across the membrane, driving the rotation of the F1 complex and ATP synthesis .

The F1 domain is composed of five different subunits: α, β, γ, δ, and ε, with a stoichiometry of α3β3γ1δ1ε1 . The F0 domain consists of subunits a, b, and c . The number of c subunits varies between organisms, influencing the efficiency of ATP synthesis .

Sodium Ion Specific ATP Synthase

Some organisms, particularly certain bacteria and archaea, utilize sodium ions (Na+) instead of protons (H+) to drive ATP synthesis. These organisms possess Na+-specific ATP synthases . An example is the A1A0 ATP synthase found in E. callanderi, which requires Na+ for catalytic activity and energy coupling .

atpI Subunit

The atpI subunit is a component of the ATP synthase complex. Specifically, atpI encodes subunit c of the F0 complex. Subunit c forms a ring-like structure that rotates as ions flow through the F0 channel . The number of c subunits in the ring determines the number of ions required to rotate the ring and synthesize one ATP molecule . The sequence of the c subunit contains transmembrane helices with Na+-binding signatures .

Mechanism of ATP Synthesis

ATP synthase harnesses the energy from the electrochemical gradient of either protons or sodium ions to synthesize ATP . The flow of ions through the F0 complex causes the c ring to rotate. This rotation is then transmitted to the γ subunit, located in the F1 complex . The rotation of the γ subunit induces conformational changes in the α and β subunits, which are the catalytic subunits responsible for ATP synthesis .

The F1 catalytic domain proceeds through several steps, including "catalytic dwells" defined by biophysical rotation experiments . Each 120° step is divided into substeps, with dwells occurring after each 120° rotation, including an "ATP binding" dwell at 30° and a "phosphate release" dwell at 95° . Phosphate release enables the enzyme to complete the 120° step, leading to the ATP binding dwell .

Inhibitors of ATP Synthase

Several inhibitors can disrupt the function of ATP synthase, including IF1 (Inhibitory Factor 1), oligomycin, and venturicidin .

  • IF1: A natural protein inhibitor that binds to the F1 catalytic domain, preventing ATP hydrolysis but not synthesis . IF1 binds at the interface between the αDP and βDP subunits, interacting with βTP386, αE355, and the γ subunit .

  • Oligomycin: Binds to the F0 subunit and blocks the proton channel, inhibiting ATP synthesis .

  • Venturicidin: Similar to oligomycin, it inhibits ATP synthesis by binding to the F0 subunit .

Role in Human Health and Disease

ATP synthase is critical for cellular metabolism, and its malfunction has been linked to various pathological conditions . Some studies have explored ATP synthase as a potential therapeutic target for human diseases .

Table: Comparison of F-type and A-type ATP synthases

FeatureF-type ATP synthasesA-type ATP synthases
Ion specificityH+Na+ or H+
OrganismsBacteria, mitochondria, chloroplastsArchaea
F1 stoichiometryα3β3γ1δ1ε1A3B3DE2FH2
F0 subunitsa, b, cc, ac
Structural SimilaritiesRelated to V-type ATPasesMore closely related to V-type ATPases

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
atpI; uncI; ATP synthase protein I, sodium ion specific
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Propionigenium modestum
Target Names
atpI
Target Protein Sequence
MNQEIKKILKNSLITSLIVLVYGIVVRNPIVYFGMFVGCLISTFCFYMICQEAESAMKSG SPFKMTVTGYMKRYAIYGIYLGILVKFFGFPVFLGGAVGLLNIKFNIFLKVVSTQFEKIK KKLSSLK
Uniprot No.

Target Background

Function

This protein may function in guiding the assembly of the membrane sector of the ATPase enzyme complex.

Protein Families
Bacterial AtpI family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of atpI in ATP synthase complexes?

AtpI is a membrane protein encoded by many bacterial ATP operons that plays a significant role in ATP synthase assembly. In various bacterial species, atpI has been identified as a protein involved in c-ring oligomer formation during the assembly of ATP synthase complexes . The sodium ion specific variant of atpI functions in ATP synthases that preferentially use sodium ions as coupling ions for ATP synthesis.

The protein exists in different forms across species, including:

  • Rhodobacter capsulatus ATP synthase protein I

  • Sodium ion specific ATP synthase protein I

  • Chlamydia trachomatis V-type ATP synthase subunit I

When expressed recombinantly, atpI typically achieves ≥85% purity as determined by SDS-PAGE analysis and can be produced in various expression systems including E. coli, yeast, baculovirus, and mammalian cells .

How does sodium ion specific atpI differ from proton-coupled variants in ATP synthase?

Sodium ion specific atpI is adapted for ATP synthases that utilize sodium ion gradients rather than proton gradients as the primary coupling mechanism. In organisms like Methanothermobacter marburgensis, the ATP synthase is primarily sodium-coupled, while other organisms like Methanosarcina mazei Gö1 contain proton-coupled variants .

An interesting finding is that even sodium ion-coupled ATP synthases can still translocate protons under conditions that favor proton transport (low pH and sodium ion concentrations) . This suggests a potential ion-switching capability in some ATP synthases.

Research with Methanobrevibacter ruminantium M1 demonstrated that its A₁Aₒ-ATP synthase exhibits sodium-coupled properties but can also use protons under certain environmental conditions:

Environmental ConditionPreferred Coupling IonRelative ATP Synthesis Efficiency
High Na⁺, neutral pHNa⁺High
Low Na⁺, low pHH⁺Moderate
Low Na⁺, high pHMixed couplingReduced

This adaptability allows methanogens to adjust their bioenergetics based on prevailing environmental conditions .

What are the optimal expression systems for recombinant sodium ion specific atpI?

The choice of expression system depends on research objectives and downstream applications. Based on available research data, multiple expression systems have been successfully used:

Expression SystemAdvantagesConsiderationsTypical Yield
E. coliRapid growth, economical, well-established protocolsMay require codon optimization, potential inclusion body formationVariable, can be optimized with tags
YeastPost-translational modifications, membrane protein expression capabilityLonger cultivation time, more complex media requirementsGood for full-length membrane proteins
BaculovirusSuperior for complex eukaryotic proteins, better foldingMore technical expertise required, higher costHigh yields of functional protein
Mammalian CellNative-like folding and modificationsMost expensive, slowest growthLower yields but highest quality

For sodium ion specific atpI, E. coli expression systems have been widely used when paired with solubility-enhancing fusion partners like maltose binding protein (MBP) . The fusion approach can significantly improve solubility while maintaining the protein's native structure.

For purification, researchers typically achieve ≥85% purity as determined by SDS-PAGE analysis . When higher purity is required, techniques like reversed-phase column chromatography with ethanol as an eluent have proven effective .

How can researchers verify the proper folding and functionality of recombinant atpI?

Verifying proper folding and functionality of membrane proteins like atpI requires multiple analytical approaches:

  • Structural verification methods:

    • Circular dichroism (CD) spectroscopy to confirm α-helical secondary structure characteristic of properly folded atpI

    • Limited proteolysis assays to evaluate structural integrity

    • Mass spectrometry for primary structure confirmation

  • Functional characterization:

    • Reconstitution into liposomes for functional studies

    • ATP synthesis/hydrolysis assays in the presence of sodium ions

    • Ion flux measurements using fluorescent probes or radioisotopes

For sodium ion specific atpI, researchers can assess its function by measuring sodium-dependent stimulation of ATP synthesis. In functional studies of ATP synthases containing atpI, sodium ions provide pH-dependent protection against DCCD (dicyclohexylcarbodiimide) inhibition, which serves as a useful functional assay .

Researchers studying atpI from Methanobrevibacter ruminantium confirmed protein identity using matrix-assisted laser desorption/ionization tandem time-of-flight mass spectrometry (MALDI TOF/TOF MS), where protein bands were excised from gels, digested with trypsin, and analyzed to verify the atpI sequence .

Is atpI absolutely required for ATP synthase assembly across all species?

Research indicates that atpI is not absolutely required for ATP synthase assembly in all species, but it contributes significantly to the stability and optimal function of the complex in many organisms.

In studies of alkaliphilic Bacillus pseudofirmus OF4, researchers created a strain with a chromosomal deletion of atpI. This mutant strain was still able to grow nonfermentatively, and its purified ATP synthase had a c-ring of normal size, indicating that AtpI is not absolutely required for ATP synthase assembly and function in this organism .

  • Reduced stability of the ATP synthase rotor

  • Reduced membrane association of the F₁ domain

  • Reduced ATPase activity

  • Modestly reduced nonfermentative growth on malate at both pH 7.5 and 10.5

These findings suggest that while atpI is not essential for basic ATP synthase assembly, it plays a significant role in optimizing complex stability and activity.

In contrast, studies with hybrid Na⁺-coupled ATP synthase containing components from Propionigenium modestum and thermophilic Bacillus showed that P. modestum atpI was necessary for c-ring formation and ATP synthase function . This indicates species-specific differences in atpI requirements.

What experimental evidence demonstrates atpI's role in c-ring assembly?

The evidence for atpI's role in c-ring assembly comes from multiple experimental approaches:

  • Deletion studies: In Bacillus pseudofirmus OF4, deletion of atpI resulted in decreased stability of c-rings. SDS-PAGE analysis showed that ATP synthase preparations from ΔatpI mutants exhibited free c-monomer in the absence of TCA treatment, indicating instability of the c-ring, while wild-type preparations maintained intact c-rings .

  • In vitro assembly experiments: Yoshida and colleagues demonstrated that atpI was necessary and sufficient for assembly of a hybrid Na⁺-coupled ATP synthase. The purified ATP synthase complexes contained a c-ring only when P. modestum atpI was included in the construct or expressed separately .

  • Activity measurements: ATP synthase from ΔatpI strains showed more than 50% reduction in ATP-driven proton-pumping activity compared to wild-type, and a 30% reduction in ATPase activity . This functional deficit provides indirect evidence of atpI's role in proper c-ring assembly.

  • Quantitative analysis: The yield of enzyme from ΔatpI strains was lower (0.7-0.8 mg/liter) compared to wild-type (1 mg/liter), consistent with a reduced membrane F₁ content .

It's worth noting that attempts to reconstitute c-rings in vitro using the PURE system with and without atpI have yielded mixed results, suggesting that additional factors may be involved in the assembly process in vivo .

How does atpI contribute to sodium ion coupling in ATP synthases?

While the exact molecular mechanism remains under investigation, evidence suggests that atpI enhances the sodium ion specificity of ATP synthases through several possible mechanisms:

  • Stabilization of sodium-binding sites: atpI may help maintain the optimal conformation of c-subunits that contain sodium ion-binding sites.

  • Co-transport of sodium ions: Research with alkaliphilic Bacillus pseudofirmus OF4 suggests that atpI may function as a transporter or channel protein for ions, potentially including sodium .

  • Signal transduction: Some evidence suggests atpI could act as a sensor for sodium ion concentration, helping to regulate ATP synthase activity based on available sodium ion gradients.

The sodium ion-binding signature in the c-subunits of all methanogen enzymes points to a evolutionary adaptation for sodium ion coupling . In the case of Methanobrevibacter ruminantium, its ATP synthase was shown to be stimulated by sodium ions, which also provided pH-dependent protection against DCCD inhibition, characteristic of sodium-coupled enzymes .

Does atpI have roles beyond ATP synthase assembly in ion homeostasis?

Evidence suggests that atpI has additional functions beyond ATP synthase assembly, particularly in ion homeostasis:

  • Magnesium transport: Deletion of atpI, atpZ, or both from Bacillus pseudofirmus OF4 led to a requirement for greatly increased concentration of Mg²⁺ for growth at pH 7.5 . Either atpI, atpZ, or atpZI complemented the phenotype of a triple mutant of Salmonella typhimurium (MM281) that is deficient in Mg²⁺ uptake .

  • Calcium transport: atpI and atpZ increased the Mg²⁺-sensitive ⁴⁵Ca²⁺ uptake by vesicles of an Escherichia coli mutant defective in Ca²⁺ and Na⁺ efflux .

  • Channel formation: It has been hypothesized that AtpI, either as homooligomers or heterooligomers with AtpZ, may function as Mg²⁺ transporter, Ca²⁺ transporter, or channel proteins .

These functions could provide essential ions required by ATP synthase and support charge compensation when the enzyme is functioning in the hydrolytic direction, especially during processes like cytoplasmic pH regulation .

How can researchers effectively use recombinant atpI for structural studies of ATP synthase?

For structural studies of ATP synthase incorporating recombinant atpI, researchers should consider the following methodological approach:

  • Expression and purification strategy:

    • Use fusion tags like MBP to improve solubility

    • Consider detergent selection carefully for membrane protein extraction

    • Implement multistep purification including affinity chromatography followed by size exclusion

    • For structural studies, achieve >95% purity through additional purification steps

  • Reconstitution approaches:

    • Incorporate purified atpI into liposomes using appropriate lipid compositions

    • For sodium ion specific atpI, consider using crude soybean phosphatidylcholine preparation (Type II-S) which has been successfully used for reconstitution of alkaliphilic ATP synthase

    • Verify proper incorporation using freeze-fracture electron microscopy

  • Structural analysis methods:

    • X-ray crystallography remains challenging for membrane proteins

    • Cryo-electron microscopy (cryo-EM) has emerged as the method of choice for ATP synthase structural studies

    • NMR spectroscopy for dynamic studies of specific domains

Recent advances in ATP synthase structural biology have yielded high-resolution structures through X-ray diffraction crystallography, though complete ATP synthase complexes remain challenging to crystallize . Since 1999, only six successful attempts have resulted in high-resolution XRD structures of ATP synthase from different organisms .

What are the most effective approaches for studying atpI interactions with other ATP synthase components?

Studying protein-protein interactions involving atpI requires specialized techniques suited for membrane proteins:

  • Cross-linking approaches:

    • Chemical cross-linking coupled with mass spectrometry

    • Site-directed cross-linking to identify specific interaction points

    • In vivo photo-cross-linking for capturing transient interactions

  • Biophysical methods:

    • Surface plasmon resonance (SPR) with detergent-solubilized proteins

    • Microscale thermophoresis for measuring binding affinities

    • Förster resonance energy transfer (FRET) assays to monitor interactions in reconstituted systems

  • Genetic approaches:

    • Bacterial two-hybrid systems adapted for membrane proteins

    • Suppressor mutation analysis to identify functional interactions

    • Deletion complementation studies as performed with atpI and atpZ in Bacillus pseudofirmus OF4

For example, researchers investigating alkaliphilic Bacillus pseudofirmus OF4 examined interactions between atpI and ATP synthase components through complementation studies. They found that while single deletions of spoIIIJ or yqjG (two YidC/OxaI/Alb3 family proteins) did not affect membrane ATP synthase levels or activities, functional specialization was indicated by YqjG and SpoIIIJ showing respectively greater roles in malate growth at different pH levels .

Does atpI have potential as a therapeutic target in microbial infections?

While ATP synthase has been identified as a potential therapeutic target, particularly for antibacterial treatments, the specific targeting of atpI requires further research:

  • Antimicrobial potential:

    • ATP synthase inhibitors like bedaquiline are already used as anti-tuberculosis drugs targeting mycobacterial ATP synthase

    • Given atpI's role in ATP synthase stability and function, it represents a potential alternative target with species-specific features

  • Considerations for atpI as a target:

    • Species-specific differences in atpI requirement and function need careful consideration

    • In some organisms (like Bacillus pseudofirmus OF4), atpI is not essential but affects efficiency

    • In others, atpI may be critical for ATP synthase assembly and function

  • Research approaches for therapeutic development:

    • Structure-based drug design using high-resolution structural data of atpI

    • Screening for compounds that specifically disrupt atpI-mediated protein-protein interactions

    • Development of peptide inhibitors modeled after natural ATP synthase inhibitors

The structure-based approach has been successful for targeting other components of ATP synthase, as demonstrated with bedaquiline which targets the c-ring of mycobacterial ATP synthase . Similar approaches could be applied to atpI, particularly for sodium ion specific variants in pathogenic organisms.

What are the most promising directions for future research on sodium ion specific atpI?

Several research directions hold particular promise for advancing our understanding of sodium ion specific atpI:

  • Structural biology:

    • Obtaining high-resolution structures of sodium ion specific atpI in different conformational states

    • Mapping the sodium ion binding sites and understanding the coordination chemistry

    • Determining how atpI interacts with other components of the ATP synthase complex

  • Functional studies:

    • Investigating the ion specificity switching mechanisms between sodium and proton coupling

    • Understanding how environmental factors influence coupling ion preference

    • Exploring the role of atpI in ion homeostasis beyond ATP synthase function

  • Evolutionary perspectives:

    • Comparative studies of atpI across species adapted to different environments

    • Investigation of horizontal gene transfer events involving atpI

    • Understanding the co-evolution of atpI with other ATP synthase components

  • Biotechnological applications:

    • Engineering atpI for improved ATP synthase stability in biotechnological applications

    • Developing biosensors based on ion-sensing properties of atpI

    • Creating synthetic ATP synthase systems with controlled ion specificity

The role of atpI in modulating the ion specificity of ATP synthase is particularly relevant for understanding how organisms adapt to environmental challenges, such as those faced by extremophiles and pathogens in various ecological niches .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.