Recombinant ATP synthase protein I (atpI)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant ATP Synthase Protein I (AtpI)

Recombinant ATP Synthase Protein I (AtpI) is a membrane-associated chaperone encoded by the atpI gene, which is part of bacterial atp operons. AtpI facilitates the assembly and stability of the Fo_o domain of ATP synthase, a critical enzyme for ATP production. While not essential for ATP synthase function, AtpI ensures structural integrity and optimal enzymatic activity, particularly under stress conditions .

Mechanistic Insights

  • Deletion of atpI reduces membrane-bound F1_1β subunits by 34% and increases cytoplasmic F1_1 levels by 2.7-fold, indicating impaired Fo_o-F1_1 assembly .

  • AtpI-deficient ATP synthase exhibits reduced ATPase activity (0.63 ± 0.11 U/mg in mutants vs. ~1.0 U/mg in wild-type) .

Table 1: Phenotypic Effects of atpI Deletion in Bacillus pseudofirmus OF4

ParameterWild-Type (WT)ΔatpI Mutant
F1_1β in membrane100%66%
Cytoplasmic F1_1β1x2.7x
Nonfermentative growthNormalReduced
ATP synthase stabilityHighReduced

Functional Redundancy and Specialization

  • AtpZ: A gene upstream of atpI involved in magnesium uptake; deletion increases Mg2+^{2+} requirements at pH 7.5 .

  • SpoIIIJ/YqjG: YidC-family chaperones with overlapping roles; SpoIIIJ is critical at pH 10.5, while YqjG dominates at pH 7.5 .

Table 2: Chaperone Roles in ATP Synthase Assembly

ProteinFunctionImpact of Deletion
AtpIStabilizes Fo_o rotor, F1_1 membrane associationReduced ATPase activity, growth defects
AtpZMagnesium acquisitionIncreased Mg2+^{2+} dependency
SpoIIIJMembrane protein insertionpH-dependent growth defects
YqjGMembrane protein insertionImpaired pH 7.5 growth

Therapeutic and Biotechnological Implications

While direct therapeutic applications of recombinant AtpI remain unexplored, its role in ATP synthase assembly highlights potential for:

  • Antimicrobial Strategies: Targeting bacterial ATP synthase assembly via AtpI inhibition .

  • Metabolic Engineering: Enhancing ATP synthase efficiency in industrial microbes .

Future Directions

  • Investigating AtpI’s interaction with other assembly factors (e.g., SpoIIIJ/YqjG) under varying pH conditions .

  • Structural studies to resolve AtpI’s binding sites on the c-ring or F1_1 sector .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpI; ATP synthase protein I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-144
Protein Length
full length protein
Species
Streptomyces lividans
Target Names
atpI
Target Protein Sequence
MPSNDVRILLQAAVPAAAVGAVAAVVSAVVAGGKGAVGAVVATVLAMLFMGIGLYVLQRT AKSLPHLFQAMGLMLYAAQILLLFVFLAAFKNTTLFNPRSFAVSLLVVTLAWIAAQTRAH MKAKVLYVEPEPTGEKPEKTGHSS
Uniprot No.

Target Background

Function
This protein is believed to play a role in guiding the assembly of the membrane sector of the ATP synthase enzyme complex.
Protein Families
Bacterial AtpI family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is ATP synthase protein I (atpI) and how does it function in the ATP synthase complex?

ATP synthase protein I (atpI) is a membrane protein component of the Fo sector of ATP synthase. It plays a crucial role in the architecture of the membrane-embedded portion of ATP synthase, contributing to proton translocation across the membrane. Unlike the catalytic beta subunit (ATP5F1B) that directly participates in ATP formation from ADP and inorganic phosphate, atpI helps maintain the structural integrity of the complex in the membrane .

The ATP synthase complex consists of two major sectors: F1 (containing the catalytic subunits) and Fo (embedded in the membrane). The beta subunits in the F1 sector can adopt different conformations to bind Mg-ADP (βDP), Mg-ATP (βTP), or remain empty (βE) during the catalytic cycle . AtpI contributes to the proton channel formation that enables the electrochemical gradient to drive ATP synthesis.

What expression systems are most suitable for producing recombinant ATP synthase components?

Based on the available research, several expression systems have proven effective for producing recombinant ATP synthase components:

Expression SystemAdvantagesBest ForChallenges
YeastPost-translational modifications, high yieldFull-length mature proteinsGlycosylation patterns may differ from mammalian
E. coliCost-effective, rapid productionSoluble ATP synthase domainsLimited post-translational modifications
Mammalian cellsNative-like modificationsHuman ATP synthase studiesHigher cost, lower yield
Baculovirus/insectHigh yield of complex proteinsMulti-subunit assembliesMore complex setup

The search results indicate that yeast expression systems can effectively produce recombinant human ATP synthase subunits with high purity (>90%), yielding functional proteins with expected molecular weight (~54 kDa for ATP5F1B) . For instance, human ATP5F1B (amino acids 48-529) with an N-terminal 6xHis-tag has been successfully expressed in yeast to obtain the recombinant full-length mature protein .

How do researchers verify the structural integrity of recombinant ATP synthase proteins?

Verifying structural integrity of recombinant ATP synthase proteins involves multiple complementary techniques:

  • SDS-PAGE analysis is typically used as a primary assessment method to confirm the expected molecular weight and purity (>90% for research-grade preparations) .

  • Western blotting with specific antibodies confirms the identity of the recombinant protein, particularly useful when tags (such as 6xHis) are incorporated into the construct .

  • Circular dichroism spectroscopy helps assess secondary structure elements to ensure proper protein folding.

  • Activity assays measure ATP hydrolysis or synthesis rates to confirm functional integrity.

  • For more detailed structural analysis, electron microscopy (EM) and atomic force microscopy (AFM) can visualize properly assembled ATP synthase complexes reconstituted into lipid bilayers .

What methods are most effective for reconstituting ATP synthase into lipid bilayers for structural studies?

Two primary methods have proven effective for reconstituting mitochondrial ATP synthase into lipid bilayers for structural studies:

Method 1: Proteoliposome Preparation
This approach involves creating proteoliposomes densely packed with ATP synthase through controlled detergent removal from ternary mixtures containing lipid, detergent, and protein . The process typically follows these steps:

  • Solubilize purified ATP synthase in an appropriate detergent (often digitonin or n-dodecyl-β-D-maltoside).

  • Mix with lipids (typically phosphatidylcholine and phosphatidic acid) at optimal lipid-to-protein ratios.

  • Remove detergent gradually using controlled dialysis or hydrophobic adsorption (Bio-Beads).

  • Verify incorporation using freeze-fracture electron microscopy or functional assays.

This method results in vesicles containing multiple ATP synthase complexes suitable for bulk functional studies and some structural analyses .

Method 2: Supported Monolayer Technique
This approach is particularly valuable for creating two-dimensional crystals with uniform orientation:

  • Generate a lipid monolayer at an air-water interface.

  • Add hexahistidine-tagged ATP synthase to the subphase.

  • The histidine tags bind to the lipid monolayer (often containing Ni-NTA lipids), orienting the proteins uniformly.

  • This creates two-dimensional arrays where the F1 catalytic subcomplex faces the lipid monolayer and F0 membrane regions face the solution .

This configuration is particularly advantageous for determining c-ring stoichiometry and studying the organization of membrane-intrinsic subunits within F0 using electron microscopy and AFM .

How does RNA promote mitochondrial import of ATP synthase subunits and what are the experimental approaches to study this process?

Recent research has uncovered a surprising role for RNA in facilitating the mitochondrial import of ATP synthase subunits. Specific cytosolic RNAs bind to ATP synthase precursor proteins at the outer surface of mitochondria and promote their mitochondrial import both in vitro and in vivo .

Experimental approaches to study this process include:

  • RNA interactome capture experiments: These have identified F1-ATPase subunits ATP5A1 (α), ATP5B (β), and ATP5C1 (γ) as RNA binders in mammalian cells .

  • Complex capture (2C) assay: This technique leverages RNA binding to silica columns. After UV-crosslinking RBPs to RNA in living cells and 2C selection under denaturing conditions, researchers detected ATP5A1, ATP5B, and ATP5C1 co-purifying with RNA, while control proteins (TOM20, H3) did not .

  • Immunoprecipitation with radioactive labeling: Immunoprecipitated ATP5A1 or ATP5C1 can be tested for RNA association using end-labeling with radioactive ATP and polynucleotide kinase (PNK). The characteristic radioactive smear indicates RNA binding and is eliminated by RNase treatment .

  • Enhanced mitochondrial targeting signal (eMTS) engineering: To distinguish between precursor and mature forms of ATP synthase subunits (which differ by only ~2 kDa), researchers engineered an ATP5A1 variant with an internal V5 epitope tag within the disordered/flexible region of the original MTS. This facilitates selective identification of the pre-protein version and improves size differentiation in biochemical assays .

Further analysis of ATP5A1-RNA interactions revealed that:

  • ATP5A1 binds 422 regions across 275 unique RNAs

  • Approximately 86% of identified ATP5A1 targets are cytosolic mRNAs

  • The bound RNAs share specific sequence motifs: a ~10-nucleotide polypyrimidine (CU) motif in 5'UTR regions or a ~20-nucleotide G-rich motif in 3'UTR/3'UTR-CDS regions

What experimental design considerations are crucial for studying ATP synthase function in different cellular contexts?

When designing experiments to study ATP synthase function, several critical design considerations must be addressed:

1. Controlling Variables in ATP Synthase Studies:

Variable TypeExamples in ATP Synthase ResearchControl Method
IndependentATP concentration, pH, membrane potentialSystematic manipulation with defined increments
DependentATP production rate, proton flux, complex assemblyReliable quantification methods
ExtraneousCellular energy state, other enzyme activitiesInhibitors, genetic knockdowns, isolated systems
ConfoundingTemperature fluctuations, sample degradationStabilized experimental conditions, time controls

2. Randomization and Replication:
Proper experimental design requires adequate randomization to minimize systematic errors and sufficient replication to ensure statistical power . For ATP synthase studies:

  • Sample randomization should address potential batch effects in protein preparations

  • Blind analysis prevents experimenter bias in activity measurements

  • Technical replicates (minimum 3) account for measurement variability

  • Biological replicates (different preparations) account for biological variability

3. Appropriate Controls:
Crucial controls for ATP synthase experiments include:

  • Positive controls: Known functional ATP synthase preparations

  • Negative controls: Heat-inactivated enzyme or preparations with specific inhibitors (oligomycin)

  • Vehicle controls: When solvents (DMSO) are used to deliver compounds

  • System controls: Measuring background hydrolysis/synthesis rates

4. Method-Specific Considerations:
When studying ATP synthase reconstituted in lipid bilayers, specific methodological controls are needed:

  • Verifying orientation of reconstituted complexes (inside-out vs. right-side-out)

  • Confirming proton impermeability of vesicles before protein incorporation

  • Measuring protein-to-lipid ratios consistently across preparations

What are the current best practices for purifying recombinant ATP synthase subunits with optimal yield and activity?

Purification of recombinant ATP synthase subunits requires specific approaches to maintain structural integrity and activity:

Purification Strategy for His-Tagged ATP Synthase Subunits:

  • Expression optimization: For yeast-expressed human ATP5F1B, expression at lower temperatures (20-25°C) often improves folding and solubility .

  • Cell lysis: Gentle lysis methods using enzymatic approaches (lysozyme for bacteria) or mechanical disruption (glass beads for yeast) in the presence of protease inhibitors preserve protein integrity .

  • Affinity chromatography: For His-tagged subunits like ATP5F1B (amino acids 48-529 with N-terminal 6xHis-tag), nickel or cobalt affinity chromatography under native conditions is effective .

  • Buffer optimization: Purification buffers typically contain:

    • Mild detergents (0.05-0.1% DDM or digitonin) to maintain solubility

    • Stabilizing agents (glycerol 10-15%)

    • Reducing agents (DTT or β-mercaptoethanol)

    • Divalent cations (Mg2+) to stabilize nucleotide binding sites

  • Secondary purification: Size exclusion chromatography further improves purity and removes aggregates, yielding >90% pure protein as verified by SDS-PAGE .

For reconstituting functional ATP synthase complexes, the lipid composition and protein-to-lipid ratio are critical parameters that must be optimized empirically for each experimental system .

How can researchers effectively study the role of ATP synthase in disease models?

Studying ATP synthase in disease contexts requires specialized approaches:

1. Disease-Relevant Experimental Models:

Disease ContextRecommended Model SystemsKey ATP Synthase Parameters
Neurodegenerative disordersPrimary neurons, patient-derived iPSCsATP production, ROS generation, membrane potential
Cardiovascular diseasesCardiomyocytes, heart tissue slicesComplex assembly, proton leak, calcium sensitivity
Metabolic disordersHepatocytes, skeletal muscle cellsRegulatory modifications, substrate preference
CancerCancer cell lines, patient-derived xenograftsExpression alterations, inhibitor sensitivity

2. Analytical Approaches:

  • Structural alterations: Compare ATP synthase assembly in normal versus disease states using blue native PAGE, co-immunoprecipitation, or crosslinking mass spectrometry .

  • Functional changes: Measure ATP synthesis rates in isolated mitochondria or permeabilized cells using luciferase-based assays or HPLC-based nucleotide quantification .

  • Regulatory modifications: Examine post-translational modifications (phosphorylation, acetylation) and their impact on ATP synthase activity in disease contexts .

  • RNA-protein interactions: Investigate altered RNA binding to ATP synthase subunits using the complex capture assay or immunoprecipitation approaches described in the research on ATP5A1 .

3. Therapeutic Targeting Strategies:

Researchers can explore therapeutic approaches by:

  • Developing antibodies against specific ATP synthase subunits for research and potential therapy

  • Screening small molecule modulators of ATP synthase activity

  • Testing RNA-based approaches to modulate ATP synthase import and assembly based on recent findings about RNA-protein interactions

What techniques provide the most accurate assessment of ATP synthase activity in different experimental preparations?

Multiple complementary techniques provide comprehensive assessment of ATP synthase activity:

1. Direct Activity Measurements:

  • ATP synthesis assays: Monitor ATP production in reconstituted systems or isolated mitochondria using luciferase-based bioluminescence or NADP+/glucose-6-phosphate dehydrogenase coupled assays.

  • ATP hydrolysis assays: Measure inorganic phosphate release using colorimetric methods (malachite green) or enzyme-coupled assays.

  • Proton pumping assays: Monitor pH changes using pH-sensitive fluorescent dyes (ACMA, pyranine) in reconstituted proteoliposomes .

2. Structural and Functional Imaging:

  • Electron microscopy (EM): Visualize the structural integrity of reconstituted ATP synthase in lipid bilayers or isolated mitochondria .

  • Atomic force microscopy (AFM): Examine the topography and organization of ATP synthase complexes in supported lipid bilayers, particularly useful for determining c-ring stoichiometry and organization of membrane-intrinsic subunits .

  • Fluorescence recovery after photobleaching (FRAP): Assess lateral mobility of labeled ATP synthase complexes in membranes.

3. Computational Analysis:

Evaluate ATP synthase activity data using appropriate statistical methods:

  • Michaelis-Menten kinetics for enzyme activity analysis

  • Statistical tests (ANOVA, t-tests) with appropriate randomization controls

  • Correction for multiple testing when screening multiple conditions

The combination of biochemical activity assays with structural visualization techniques provides the most comprehensive assessment of ATP synthase functionality across different experimental systems.

What emerging technologies are transforming ATP synthase research?

Several cutting-edge technologies are reshaping ATP synthase research:

  • Cryo-electron microscopy (cryo-EM): Enables high-resolution structural determination of ATP synthase without crystallization, revealing dynamic states during the catalytic cycle.

  • Single-molecule techniques: Allow direct observation of rotary motion and conformational changes in individual ATP synthase molecules, providing insights into mechanistic details not accessible through bulk measurements.

  • RNA-protein interaction mapping: New approaches for identifying specific RNA sequences that bind ATP synthase subunits and modulate their mitochondrial import and assembly, as demonstrated by the identification of polypyrimidine and G-rich motifs in RNAs that interact with ATP5A1 .

  • Genome editing technologies: CRISPR-Cas9 approaches enable precise modification of ATP synthase genes to study the impact of disease-associated mutations or create reporter systems for monitoring assembly and activity in living cells.

  • Artificial membrane systems: Advanced lipid bilayer technologies such as supported monolayers allow controlled reconstitution of ATP synthase with defined orientation and composition, facilitating structural and functional studies .

How do researchers reconcile contradictory findings in ATP synthase research?

Contradictory findings in ATP synthase research often arise from differences in experimental systems, methodologies, or interpretations. Researchers can address these discrepancies through:

  • Systematic comparison of experimental conditions: Carefully document and compare buffer compositions, lipid environments, protein preparations, and assay conditions that might explain divergent results.

  • Cross-validation using multiple techniques: Employ orthogonal methods to verify findings, such as combining structural (EM, AFM) and functional (activity assays) approaches when studying ATP synthase .

  • Standardization of protocols: Develop community-accepted standard protocols for ATP synthase purification, reconstitution, and activity measurement to facilitate direct comparison between studies.

  • Meta-analysis of published data: Systematically review multiple studies to identify patterns, common findings, and potential sources of variability.

  • Collaborative research initiatives: Establish multi-laboratory studies where the same samples and protocols are used across different research groups to validate key findings.

When apparent contradictions arise, researchers should consider differences in:

  • Organism sources (bacterial vs. mitochondrial ATP synthase)

  • Lipid compositions in reconstitution experiments

  • Detergents used during purification

  • Presence of post-translational modifications

  • Subunit composition and completeness of the ATP synthase complex

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.