Recombinant ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Description

Introduction to ATP Synthase Subunit a (atpI)

ATP synthase subunit a, chloroplastic (atpI) constitutes an integral membrane protein component of the chloroplast ATP synthase complex. Specifically, atpI forms part of the membrane-embedded CFo sector, which functions as the proton channel of the ATP synthase machinery. Within the CFo subcomplex, atpI collaborates with the tetradecameric ring of AtpH subunits to establish the complete membrane-embedded proton channel, facilitating the controlled flow of protons that drives ATP synthesis . The chloroplast CFo-CF1-ATP synthase drives the reversible synthesis of ATP from ADP and inorganic phosphate (Pi) by harnessing energy from the light-driven proton electrochemical gradient, or proton motive force (pmf) .

The architectural organization of chloroplast ATP synthase resembles that of bacterial and mitochondrial counterparts, comprising two principal subcomplexes. The membrane-embedded CFo subcomplex converts energy from proton flux into rotational motion, while the water-soluble CF1 subcomplex couples this rotational motion to ATP synthesis . AtpI represents one of the four subunits (AtpF, AtpG, AtpH, and AtpI) that constitute the CFo sector, with these subunits accumulating in a stoichiometric ratio of 1:1:14:1, respectively .

Genomic Context and Transcription

In Chlamydomonas reinhardtii and other green algae, the atpI gene resides within the chloroplast genome as part of a polycistronic transcription unit. This genetic organization includes several other photosynthesis-related genes: psbD (encoding the PSII D2 protein), the second exon of psaA (encoding an apoprotein of Photosystem I), psbJ (encoding a PSII subunit), atpI, psaJ (encoding a PSI subunit), and rps12 (encoding ribosomal protein Rps12) . This clustering of genes involved in different aspects of photosynthesis highlights the coordinated regulation of these essential components.

The atpI gene undergoes complex transcriptional processing, resulting in four major atpI-containing transcripts in wild-type organisms:

  1. Tetracistronic psbJ-atpI-psaJ-rps12 transcripts

  2. Tricistronic atpI-psaJ-rps12 transcripts

  3. Dicistronic atpI-psaJ transcripts

  4. Monocistronic atpI transcripts

Post-transcriptional Regulation by MTHI1

A distinctive aspect of atpI expression involves its post-transcriptional regulation by the octotricopeptide repeat (OPR) protein MTHI1 (Maturation/Translation of atpH and atpI). Unlike most trans-acting factors that control the expression of a single gene in Chlamydomonas, MTHI1 targets two distinct transcripts: it enhances the translation of atpI mRNA while also being required for the accumulation and translation of atpH mRNA .

MTHI1 appears to recognize and bind to a specific sequence located approximately 60 nucleotides upstream of the atpI initiation codon. This sequence bears significant similarity to a conserved sequence found at the 5' end of triphosphorylated atpH mRNA. The presence of this binding site is essential for atpI mRNA translation in Chlamydomonas, providing a mechanism for the coregulation of the two proton hemi-channels formed by AtpI and AtpH .

Impact of MTHI1 on atpI Expression

Experimental evidence from mthi1 mutants demonstrates the critical role of MTHI1 in atpI expression. In the absence of functional MTHI1, several significant alterations in atpI expression have been observed:

  1. The accumulation of all atpI transcripts is reduced by approximately 60%

  2. The di- and monocistronic transcripts show more dramatic reductions of approximately 85% and 75%, respectively

  3. The synthesis of AtpI protein is strongly reduced, as demonstrated in 14C pulse-labeling experiments

These findings confirm that MTHI1 serves as a major actor in the biogenesis of chloroplast ATP synthase by coregulating the expression of AtpH and AtpI, the two subunits that together form the proton channel.

Experimental Validation of atpI Translation Regulation

To investigate the relationship between atpI transcript accumulation and translation, researchers constructed an untranslatable version of the atpI gene (atpI St) with the initiation codon replaced by an amber stop codon. This mutated gene was used to replace the endogenous atpI gene, resulting in transformants unable to perform phototrophic growth due to the absence of AtpI synthesis. Interestingly, the mutated atpI transcripts accumulated to the same levels as those in control strains transformed with an unmodified atpI gene . This observation suggests that the reduced accumulation of atpI mRNA in mthi1 mutants is primarily a consequence of reduced transcript stability rather than altered transcription rates.

Chloroplast Transformation Experiments with atpI
Plasmid
pKrΔatpI
pKrΔatpI
pKr5′psaA-atpI
patpIKStr

Functional Role of atpI in ATP Synthase

ATP synthase subunit a (atpI) serves as an essential component of the membrane-embedded proton channel within the CFo sector of chloroplast ATP synthase. Together with the AtpH subunits (which form a tetradecameric ring), atpI establishes the complete proton translocation pathway necessary for ATP synthesis .

The chloroplast ATP synthase drives the reversible synthesis of ATP from ADP and inorganic phosphate using energy harvested from the light-driven proton electrochemical gradient. This process involves the conversion of energy from proton flux into rotational motion by the CFo subcomplex, followed by the coupling of this rotational motion to ATP synthesis by the CF1 subcomplex .

Regulation of ATP Synthase Activity

The chloroplast ATP synthase is regulated at multiple levels, including activation by the proton motive force (pmf) and redox modulation via thioredoxin. The latter regulatory mechanism involves a disulfide/sulfhydryl pair on the γ subunit and modulates the amplitude of pmf required to activate the ATP synthase. This redox regulation has been proposed to prevent wasteful ATP hydrolysis in the dark .

While these regulatory mechanisms primarily involve components of the CF1 sector (particularly the γ subunit), the CFo sector - including atpI - plays a critical role in responding to these regulatory signals by mediating proton translocation according to the established electrochemical gradient and enzyme activation state.

Recombinant Expression and Applications of atpI

The development of recombinant expression systems for ATP synthase components, including atpI, has facilitated detailed structural and functional studies of this complex. Recombinant atpI production faces particular challenges due to its hydrophobic nature and membrane integration requirements, necessitating specialized expression systems and purification protocols.

Experimental Approaches for atpI Study

Researchers have employed various chimeric constructs and genetic modifications to investigate atpI function and regulation. For instance, the creation of the aAdI chimera (comprising the psaA 5'UTR-atpI CDS-atpI 3'UTR) enabled the examination of translation regulation mechanisms by altering the 5' untranslated region (UTR) while maintaining the coding sequence of atpI .

Similarly, the development of the atpISt variant, which contains an amber stop codon in place of the initiation codon, allowed investigators to distinguish between effects on transcript stability and translation efficiency. These experimental tools have proven valuable for dissecting the complex regulatory networks governing atpI expression and function .

Coordination Between Genetic Compartments

The biogenesis of functional ATP synthase requires tight coordination between the chloroplast and nuclear genomes, as the complex comprises subunits encoded in both genetic compartments. This coordination involves numerous nucleus-encoded factors that control various post-transcriptional steps of chloroplast gene expression, including processing, trimming, splicing, editing, stabilization, translation activation, and RNA decay .

In Chlamydomonas reinhardtii, nucleus-encoded factors primarily belong to two major functional classes: M factors involved in chloroplast mRNA maturation and stabilization, and T factors required for mRNA translation activation. Many of these factors belong to helical repeat protein families, such as PPR (PentatricoPeptide Repeat), HAT (Half A Tetratricopeptide repeat), mTERF (mitochondrial TERmination Factor), and OPR (octatricopeptide repeat) proteins .

MTHI1, as an OPR protein, exemplifies this nuclear control over chloroplast gene expression by specifically regulating the expression of atpI and atpH, thereby ensuring their coordinated accumulation for proper ATP synthase assembly.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order remarks. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-251
Protein Length
full length protein
Species
Euglena gracilis
Target Names
atpI
Target Protein Sequence
MKIVLLYYFVNMFISGIFQIANVEVGQHFYWSILGFQIHGQVLINSWIVILIIGFLSIYT TKNLTLVPANKQIFIELVTEFITDISKTQIGEKEYSKWVPYIGTMFLFIFVSNWSGALIP WKIIELPNGELGAPTNDINTTAGLAILTSLAYFYAGLNKKGLTYFKKYVQPTPILLPINI LEDFTKPLSLSFRLFGNILADELVVAVLVSLVPLIVPVPLIFLGLFTSGIQALIFATLSG SYIGEAMEGHH
Uniprot No.

Target Background

Function
ATP synthase subunit a, chloroplastic (atpI), is a key component of the proton channel. It plays a direct role in the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is ATP synthase subunit a, chloroplastic (atpI) and what is its role in photosynthetic organisms?

ATP synthase subunit a, chloroplastic (atpI) is a membrane protein encoded by the chloroplast genome that forms part of the F₀ membrane sector of the chloroplast ATP synthase complex. This complex contains subunits of both plastid and nuclear genetic origin that must be coordinated during biogenesis. The atpI subunit contributes to the proton channel within the membrane-embedded portion of ATP synthase and plays a role in the assembly and stability of the complex . Unlike its bacterial homologs, the chloroplastic atpI has evolved specific adaptations for functioning in the thylakoid membrane environment. In photosynthetic organisms, the proper assembly and function of ATP synthase is critical for ATP production during photophosphorylation, which harnesses the proton gradient established by photosynthetic electron transport to generate ATP .

How can researchers express and purify recombinant ATP synthase subunit a, chloroplastic (atpI) for functional studies?

Expression and purification of recombinant atpI presents several challenges due to its hydrophobic nature as a membrane protein. A methodological approach includes:

  • Expression system selection: While E. coli is commonly used, chloroplastic membrane proteins often benefit from expression in green algal systems like Chlamydomonas reinhardtii, which provide the appropriate membrane insertion machinery and post-translational modifications .

  • Vector design: Incorporating affinity tags (His, FLAG) at the N-terminus rather than C-terminus generally yields better results, as the C-terminus may be important for proper folding and function. Including native chloroplast promoters and 5'UTR elements improves expression efficiency .

  • Solubilization protocol:

    • Membrane fraction isolation using differential centrifugation

    • Careful selection of detergents (n-dodecyl-β-D-maltoside or octyl glucoside) for solubilization

    • Maintenance of critical lipid interactions during purification

  • Purification strategy: A two-step approach combining affinity chromatography followed by size exclusion chromatography yields the purest preparations. For functional studies, co-purification with other ATP synthase subunits may be necessary to maintain native-like interactions .

  • Functional verification: Reconstitution into liposomes followed by ATP synthesis assays or proton pumping experiments using fluorescent probes like ACMA (9-amino-6-chloro-2-methoxyacridine) .

What experimental approaches are used to study atpI interactions with other ATP synthase subunits?

Several complementary approaches can be employed to investigate atpI interactions:

  • Co-immunoprecipitation studies: Using antibodies against atpI or an epitope tag to pull down interacting partners, followed by mass spectrometry identification. This has successfully demonstrated interactions between atpI and c-ring components in some systems .

  • Cross-linking coupled with mass spectrometry: This approach uses chemical cross-linkers of defined length to capture transient protein-protein interactions, providing spatial constraints for modeling. Recent studies have utilized this approach to map the interaction interface between atpI and other F₀ components .

  • Yeast two-hybrid membrane adaptations: Modified yeast two-hybrid systems designed for membrane proteins can identify binary interactions, though care must be taken to validate results through independent methods.

  • Genetic approaches: Creation of deletion or point mutations in atpI followed by analysis of ATP synthase assembly. For example, studies in alkaliphilic Bacillus pseudofirmus OF4 demonstrated that atpI deletion reduced stability of the ATP synthase rotor and membrane association of the F₁ domain .

  • In vitro reconstitution: Cell-free expression systems containing individual subunits can be used to systematically analyze the assembly process and identify required interaction partners .

What model organisms are most suitable for studying chloroplastic atpI function?

The following model organisms offer distinct advantages for chloroplastic atpI research:

  • Chlamydomonas reinhardtii: This unicellular green alga is particularly valuable due to its well-established chloroplast transformation systems, allowing direct genetic manipulation of the atpI gene. Recent studies have used C. reinhardtii to characterize chloroplast ATP synthase biogenesis by isolating novel ATP synthase mutants through screening for high light sensitivity .

  • Arabidopsis thaliana: While chloroplast transformation is challenging in higher plants, Arabidopsis offers powerful nuclear genome manipulation tools and a wealth of existing mutants. CRISPR-Cas9 techniques targeting nuclear-encoded factors that interact with atpI have provided insights into assembly mechanisms.

  • Synechocystis sp. PCC 6803: This cyanobacterium serves as a prokaryotic model for photosynthetic membranes and allows easier genetic manipulation than eukaryotic systems. Studies in cyanobacteria have helped elucidate the evolutionary conservation of atpI function.

  • Transplastomic tobacco: For higher plant studies requiring chloroplast genome manipulation, tobacco remains the gold standard, offering relatively efficient chloroplast transformation protocols for studying atpI in a multicellular plant context.

Selection of the appropriate model system depends on the specific research questions, with C. reinhardtii offering the best combination of genetic tractability and relevance to chloroplastic ATP synthase studies .

How do mutations in atpI affect ATP synthase assembly and what methodologies are most effective for assessing these effects?

Mutations in atpI can have varying effects on ATP synthase assembly, ranging from complete inhibition to subtle stability issues. The following methodologies provide comprehensive assessment:

  • Blue Native PAGE analysis: This technique preserves native protein complexes and can reveal assembly intermediates. In atpI mutants, characteristic patterns of subcomplexes can be observed, indicating specific assembly defects. Quantitative analysis of band intensities can determine the extent of assembly disruption .

  • In vivo labeling with ^35S-methionine: Pulse-chase experiments combined with immunoprecipitation can track the assembly kinetics and stability of newly synthesized ATP synthase complexes, revealing whether atpI mutations affect initial assembly or subsequent stability.

  • ATP synthase activity assays: Measurements include:

    • OG (octyl glucoside)-stimulated ATPase activity: In atpI deletion mutants of alkaliphilic Bacillus, this activity was significantly reduced compared to wild type

    • ATP-driven proton pumping: Measured by fluorescence quenching of ACMA (9-amino-6-chloro-2-methoxyacridine), this assay directly assesses functional coupling

    • ATP synthesis rates: Using luciferin/luciferase assays to measure ATP production under defined proton gradient conditions

  • Subunit distribution analysis: Western blotting of membrane and soluble fractions can reveal shifts in subunit localization. For instance, atpI deletion in Bacillus resulted in reduced membrane association of the F₁ β subunit, indicating destabilization of the F₁-F₀ interaction .

  • Electron microscopy: Both negative staining and cryo-EM approaches can visualize structural aberrations in assembled complexes from atpI mutants. Recent advances in cryo-EM have enabled visualization of subtle structural differences at near-atomic resolution.

Research has demonstrated that while atpI may not be absolutely essential for c-ring formation in all organisms (contrary to earlier beliefs), it significantly contributes to the stability of the ATP synthase rotor and proper membrane association of the F₁ domain .

What is the current understanding of atpI's chaperone-like function in ATP synthase assembly, and how can this be experimentally investigated?

The chaperone-like function of atpI in ATP synthase assembly presents a complex research area with evolving understanding:

  • Current understanding:

    • Earlier studies suggested atpI was essential for c-ring assembly in some bacterial systems like Propionigenium modestum

    • More recent evidence from alkaliphilic Bacillus pseudofirmus OF4 indicates atpI is not absolutely required for c-ring formation but enhances stability of the assembled complex and proper F₁-F₀ association

    • Chloroplastic atpI may have additional specialized functions in coordinating nuclear-encoded and plastid-encoded subunit assembly

  • Experimental investigation approaches:

    a. In vitro reconstitution systems:

    • Cell-free protein synthesis systems containing purified membrane vesicles

    • Addition or omission of atpI to assess its impact on assembly efficiency

    • Sequential addition experiments to determine the stage at which atpI acts

    • This approach was successfully used to demonstrate atpI's role in P. modestum ATP synthase assembly

    b. Site-directed mutagenesis:

    • Targeted mutations in predicted interaction domains of atpI

    • Assessment of impacts on binding to c-subunits or other partners

    • Complementation experiments with mutated versions to identify critical residues

    c. Protein-protein interaction mapping:

    • Hydrogen-deuterium exchange mass spectrometry to identify regions protected during complex formation

    • Surface plasmon resonance or microscale thermophoresis to measure binding kinetics between atpI and potential substrates

    d. Comparative analysis across species:

    • Functional complementation studies using atpI genes from diverse organisms

    • Correlation of sequence variations with differences in assembly requirements

    • Research has shown species-specific differences, with atpI being more critical in some systems than others

    e. Time-resolved assembly studies:

    • Synchronization of ATP synthase synthesis followed by time-course sampling

    • Identification of assembly intermediates that accumulate in atpI mutants

    • This can reveal the precise step at which atpI functions

These approaches collectively support a model wherein atpI functions primarily as an assembly factor that enhances efficiency and ensures proper membrane integration rather than being absolutely essential in all systems .

How does atpI interact with YidC/OxaI/Alb3 family proteins during membrane protein insertion, and what techniques can resolve potential conflicting data?

The relationship between atpI and YidC/OxaI/Alb3 family proteins represents an area with some conflicting research findings:

This area represents an excellent opportunity for researchers to resolve apparent contradictions through careful experimental design considering organism-specific adaptations and environmental conditions .

What are the methodological considerations for studying the evolutionary adaptation of chloroplastic atpI compared to its bacterial homologs?

Studying the evolutionary adaptation of chloroplastic atpI requires specialized approaches:

  • Phylogenetic analysis methodology:

    • Construction of comprehensive datasets including diverse bacterial, cyanobacterial, and chloroplastic atpI sequences

    • Use of appropriate evolutionary models accounting for membrane protein constraints

    • Consideration of coevolution with interacting subunits

    • Mapping of conserved versus variable regions onto structural models

    • Evidence suggests chloroplastic atpI evolved from cyanobacterial ancestors during primary endosymbiosis (~1.5 billion years ago)

  • Structural adaptation analysis:

    • Homology modeling based on bacterial structures combined with chloroplast-specific constraints

    • Analysis of lipid-protein interfaces using lipidomic approaches

    • Identification of adaptations to the unique thylakoid membrane environment

    • Investigation of pH-dependent structural changes relevant to light/dark transitions

  • Functional complementation across species:

    • Expression of chloroplastic atpI in bacterial systems and vice versa

    • Assessment of ATP synthase stability and function in heterologous systems

    • Identification of critical regions through chimeric constructs

    • These approaches can identify domains that confer environment-specific functionality

  • Experimental evolution approaches:

    • Laboratory evolution of photosynthetic organisms under controlled selection pressures

    • Sequencing of atpI adaptations that emerge during selection

    • Correlation of sequence changes with functional adaptations

    • This can reveal the plasticity and adaptive potential of atpI

  • Consideration of nuclear-encoded factors:

    • Investigation of species-specific nuclear factors that may interact with atpI

    • For example, research identified MDE1, an octotricopeptide repeat (OPR) protein that stabilizes atpE mRNA in Chlamydomonas

    • This nuclear-chloroplast interaction evolved relatively recently (~300 million years ago) in the ancestor of the CS clade of Chlorophyceae

This evolutionary perspective provides crucial context for understanding the functional constraints and adaptations of chloroplastic atpI, particularly in light of the endosymbiotic origin of chloroplasts and subsequent co-evolution of nuclear and chloroplast genomes .

What technical challenges exist in structural studies of recombinant atpI, and how can they be overcome?

Structural studies of recombinant atpI face several significant technical challenges:

  • Expression and purification challenges:

    ChallengeMethodological Solution
    Low expression yieldsUse specialized expression systems like C43(DE3) E. coli; codon optimization; fusion to solubility-enhancing tags that can be cleaved after purification
    Aggregation during overexpressionReduced induction temperature (16-18°C); controlled expression rate using tunable promoters; co-expression with chaperones
    Detergent selectionSystematic screening of detergents using thermal stability assays; native mass spectrometry to confirm intact protein-lipid interactions
    Maintaining native lipid environmentStyrene maleic acid lipid particles (SMALPs) or nanodiscs to extract protein with surrounding lipids; lipidomic analysis to identify critical lipids
  • Crystallization obstacles:

    • Traditional vapor diffusion techniques typically yield poor-quality crystals

    • Lipidic cubic phase (LCP) crystallization has proven more successful for membrane proteins

    • Antibody-mediated crystallization using Fv fragments that bind to hydrophilic regions

    • Surface entropy reduction through strategic mutation of flexible surface residues

  • Cryo-EM approaches:

    • Small size of isolated atpI (~25 kDa) makes it challenging for direct cryo-EM

    • Study as part of larger ATP synthase complex provides contextual structural information

    • Use of Fab fragments to increase protein size and provide fiducial markers

    • Phase plate technology to enhance contrast for smaller membrane proteins

  • NMR spectroscopy considerations:

    • Selective isotopic labeling to simplify spectra (e.g., specific amino acids or domains)

    • Perdeuteration to improve relaxation properties

    • Solid-state NMR approaches for membrane-embedded states

    • Cell-free expression systems for efficient isotopic labeling

  • Computational approaches:

    • Integration of sparse experimental constraints with advanced modeling

    • Molecular dynamics simulations to assess stability in membrane environments

    • Coevolutionary analysis to predict structural contacts

    • Ab initio modeling guided by experimental validation

Recent advances suggest that a hybrid approach combining limited experimental data with computational modeling offers the most promising path forward for structural characterization of challenging membrane proteins like atpI .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.