Recombinant ATP synthase subunit a, organellar chromatophore (atpI)

Shipped with Ice Packs
In Stock

Description

Functional Roles in ATP Synthase Assembly

AtpI plays a chaperone-like role in stabilizing the ATP synthase complex, particularly in the formation and maintenance of the c-ring rotor:

  • c-Ring Stability: Deletion of atpI in alkaliphilic Bacillus pseudofirmus OF4 led to reduced c-ring integrity, decreased membrane-associated F<sub>1</sub> domain content, and 30–50% lower ATPase activity .

  • Hybrid ATP Synthase Assembly: Coexpression of atpI with atpE (c-subunit gene) in E. coli restored c-ring oligomerization and ATP synthase activity in a chimeric enzyme .

Functional Deficit in ΔatpI MutantsImpact
c-ring dissociationIncreased free c-monomer in purified ATP synthase
F<sub>1</sub>-F<sub>O</sub> coupling34% reduction in membrane-bound β-subunit
ATP-driven proton pumping>50% activity loss

Recombinant Production

  • Expression: Optimized in E. coli with Tris-based buffer storage (50% glycerol) .

  • Purity: >90% confirmed via SDS-PAGE and Western blot .

Applications in Synthetic Biology

  • Light-Driven ATP Synthesis: Chromatophores from Rhodobacter sphaeroides (containing native ATP synthase) achieved ATP production rates of ~80 s<sup>−1</sup> per enzyme, enabling RNA transcription in artificial protocells .

  • Modular Energy Systems: Recombinant AtpI could enhance stability of synthetic ATP synthases in biohybrid systems .

Key Studies

  1. AtpI in Alkaliphiles:

    • AtpI stabilizes the rotor but is nonessential for ATP synthase function under non-stress conditions .

    • ΔatpI mutants exhibited prolonged lag phases during growth at pH 10.5 .

  2. Hybrid Enzyme Assembly:

    • AtpI from Propionigenium modestum enabled c-ring formation in a chimeric ATP synthase expressed in E. coli, confirming its role as an assembly factor .

  3. Structural Conservation:

    • Despite low sequence similarity, the Paulinella AtpI shares secondary structural features with bacterial and mitochondrial homologs, including a conserved proton pathway .

Future Directions

  • Structural Resolution: Cryo-EM studies are needed to resolve the exact orientation of AtpI within the ATP synthase complex .

  • Biotechnological Optimization: Engineering thermostable or pH-resistant AtpI variants could enhance ATP production in industrial or synthetic biology applications .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
atpI; PCC_0200; ATP synthase subunit a, organellar chromatophore; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-242
Protein Length
full length protein
Species
Paulinella chromatophora
Target Names
atpI
Target Protein Sequence
MVPLSFPFHVAELEVGQHLYWQIGNLNLHGQVFISSWVVISALLVLVITGTRKMERDPQG VQNLLEFLWDYLRDLAREQIGEKAYRDWLPFIGTLFLFIFGCNWGGALVPWKLIELPNGE LGAPTADINTTVAMALLVSLSYFYAGLSRKGLRYFEYYVEPTPIMLPFKIIEDFTKPLSL SFRLFGNILADELVVGVLAFLVPILVPLPAMFLGLFTSAIQALIFATLAANYIGEAVHEE HH
Uniprot No.

Target Background

Function
A key component of the proton channel, directly involved in proton translocation across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Plastid, organellar chromatophore thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the role of recombinant ATP synthase subunit a in organellar chromatophores?

Recombinant ATP synthase subunit a is a critical component of the F₀F₁ ATP synthase complex embedded in the membrane of chromatophores. Chromatophores are nanosized vesicles derived from photosynthetic bacteria such as Rhodobacter sphaeroides. These vesicles perform photophosphorylation, converting adenosine diphosphate (ADP) and inorganic phosphate (Pi) into adenosine triphosphate (ATP) using light energy. The subunit a of ATP synthase plays a pivotal role in proton translocation across the membrane, which drives the rotary mechanism of the enzyme's catalytic domain to synthesize ATP .

The functionality of recombinant subunit a has been extensively studied in hybrid systems where chromatophores are encapsulated within artificial giant unilamellar vesicles (GUVs). These systems mimic cellular energy transduction and provide insights into the efficiency and orientation of ATP synthesis machinery under controlled experimental conditions .

How can chromatophores be used to study light-driven ATP synthesis?

Chromatophores serve as natural organellae for studying light-driven ATP synthesis due to their ability to harness light energy to establish a proton motive force across their membrane. This proton gradient powers the F₀F₁ ATP synthase complex to catalyze the conversion of ADP and Pi into ATP. In experimental setups, chromatophores are typically isolated from photosynthetic bacteria like Rhodobacter sphaeroides and characterized using cryo-electron microscopy (cryo-EM) and spectroscopy techniques .

To study their functionality, chromatophores can be encapsulated within artificial vesicles such as GUVs. This hybrid multicompartment system allows researchers to monitor ATP production rates under various conditions, including light intensity, pH gradients, and the presence of cofactors. Quantitative assays like luciferin-luciferase bioluminescence are used to measure ATP concentrations, providing insights into the kinetics and efficiency of photophosphorylation .

What experimental methods are used to characterize recombinant ATP synthase subunit a within chromatophores?

The characterization of recombinant ATP synthase subunit a within chromatophores involves several advanced techniques:

  • Cryo-Electron Microscopy (Cryo-EM): This method provides high-resolution images of the F₀F₁ ATP synthase complex embedded in the chromatophore membrane. It reveals structural details such as the orientation and density of subunits .

  • Spectroscopy: Time-resolved spectroscopy is employed to study the photophysical processes driving proton translocation and ATP synthesis. It helps in understanding the dynamics of energy conversion .

  • Biochemical Assays: Techniques like luciferin-luciferase bioluminescence assays are used to quantify ATP production rates under controlled experimental conditions. These assays also help determine kinetic parameters such as turnover numbers and Michaelis constants .

  • Fluorescence Microscopy: Confocal fluorescence microscopy is used to visualize RNA biosynthesis driven by freshly synthesized ATP within hybrid vesicle systems. Fluorescent dyes like acridine orange are employed to track transcriptional activity .

  • Molecular Modeling: Computational approaches are used to simulate enzymatic reactions catalyzed by ATP synthase, providing theoretical insights that complement experimental findings .

How does recombinant subunit a contribute to proton motive force generation?

Recombinant subunit a is integral to the F₀ domain of ATP synthase, where it facilitates proton translocation across the chromatophore membrane. This process generates an electrochemical gradient known as the proton motive force (PMF). The PMF drives the rotary motion of the F₁ catalytic domain, enabling it to convert ADP and Pi into ATP.

Experimental studies have shown that under optimal conditions—such as pH 8.0 and near-infrared light illumination—the proton motive force across chromatophore membranes can reach approximately 130 mV. This gradient is sufficient to sustain high rates of ATP synthesis, with turnover numbers reaching up to 100 s⁻¹ per enzyme molecule . The efficiency of PMF generation depends on factors like light intensity, membrane composition, and the functional orientation of subunits within the complex.

What challenges exist in replicating natural ATP synthesis using recombinant systems?

Replicating natural ATP synthesis in recombinant systems poses several challenges:

  • Orientation of Enzymes: Ensuring that all components of the F₀F₁ ATP synthase complex are correctly oriented within artificial membranes is critical for functionality. Studies have shown that only outward-facing enzymes contribute effectively to ATP production .

  • Membrane Composition: The lipid environment surrounding recombinant proteins affects their activity and stability. Mimicking natural lipid compositions is essential for maintaining enzyme functionality .

  • Proton Leakage: Artificial systems often face issues with proton leakage across membranes, which reduces the efficiency of PMF generation and ATP synthesis .

  • Scaling Up Reactions: While small-scale experiments demonstrate high efficiency, scaling up these systems for larger applications remains challenging due to limitations in maintaining consistent environmental conditions .

  • Coupling Reactions: Integrating multiple enzymatic reactions within hybrid systems requires precise control over reaction kinetics and substrate availability .

How do hybrid multicompartment systems enhance our understanding of energy transduction?

Hybrid multicompartment systems combine biological components like chromatophores with artificial vesicles to create simplified models of cellular energy transduction. These systems allow researchers to study complex biochemical processes in controlled environments.

For example, encapsulating chromatophores within GUVs enables direct observation of light-driven ATP synthesis coupled with downstream reactions like DNA transcription and RNA biosynthesis. Such setups mimic cellular metabolism by creating out-of-equilibrium dynamics where energy flow sustains anabolic processes .

These systems also provide insights into optimizing reaction conditions for maximum efficiency, such as adjusting light intensity or substrate concentrations.

What are the applications of recombinant ATP synthase subunit a in synthetic biology?

Recombinant ATP synthase subunit a has significant applications in synthetic biology:

  • Construction of Artificial Cells: It serves as a key component in building artificial protocells capable of autonomous energy production and metabolic transformations .

  • Biochemical Pathway Engineering: By integrating recombinant enzymes into synthetic pathways, researchers can design systems for efficient production of biomolecules like RNA or proteins .

  • Energy Transduction Studies: Hybrid systems incorporating recombinant proteins enable detailed investigations into energy conversion mechanisms at molecular levels .

  • Drug Development: Understanding how recombinant enzymes function can inform strategies for targeting similar proteins in pathogenic organisms.

  • Educational Tools: Simplified models using recombinant components help illustrate fundamental principles of bioenergetics and enzymology.

How do experimental conditions affect ATP production rates in chromatophore-based systems?

ATP production rates in chromatophore-based systems depend on several experimental parameters:

  • Light Intensity: Higher light intensities generally increase proton motive force generation but may cause photodamage if excessive.

  • pH Gradient: Maintaining an optimal pH gradient across membranes is crucial for efficient proton translocation.

  • Substrate Concentrations: Adequate levels of ADP and Pi are necessary for sustained ATP synthesis.

  • Temperature: Enzyme activity typically follows an optimum temperature range; deviations can reduce efficiency or cause denaturation.

  • Membrane Composition: The lipid environment affects enzyme stability and functionality.

Studies have demonstrated that under optimized conditions—such as near-infrared illumination at 860 nm—chromatophores can achieve turnover numbers close to their theoretical maximum (~100 s⁻¹) .

What future directions exist for research on recombinant atpI?

Future research on recombinant atpI could explore:

  • Improved Hybrid Systems: Developing more stable and efficient hybrid multicompartment models for studying energy transduction.

  • Integration with Other Organellae: Combining chromatophores with other organellae like chloroplasts or mitochondria to create versatile synthetic cells.

  • Cyclic Mechanisms: Designing systems where synthesized ATP phosphorylates substrates before reverting back to ADP, mimicking natural cellular cycles.

  • High-Throughput Screening: Using automated platforms to optimize reaction conditions for various applications.

  • In Vivo Applications: Investigating how recombinant atpI functions within living organisms or engineered tissues.

By addressing these areas, researchers can unlock new possibilities in synthetic biology and bioengineering.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.