Recombinant ATP synthase subunit a, sodium ion specific (atpB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes. We will accommodate your requests whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. For specific delivery estimates, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance as additional charges will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquotting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is defined during production. If you have a specific tag preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; uncB; ATP synthase subunit a, sodium ion specific; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Propionigenium modestum
Target Names
atpB
Target Protein Sequence
MKKMGPIILAVVIAIGTFALKMMGVIGFKTPPLVEGPKIMFYVPLPEAMHDFPFAMEMAS GVYGFPVTITVISTWFVMLFLIMVFRWSSKNLEVVPERKQAFFETIYGFLDDLYGQLLGN WKKKYFTYIGTLFLFLLISNIVSFFPIPGFSSENGVFSIAPALRTPTADLNTTVGLALLT TYSFIAASFRTSGFFGFFKGLFEPMPLMFPINLAGEFAKPTNISIRLFGNMFAGMVILGL LYKAAPVLIPAPLHLYFDLFSGVVQSFVFIMLTMVYIQGSIGDAEYLED
Uniprot No.

Target Background

Function
ATP synthase subunit a, sodium ion specific (atpB) is a crucial component of the proton channel. It plays a direct role in the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the fundamental structure and function of sodium ion-specific ATP synthase?

ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core (F1) and the membrane-spanning component (Fo), which comprises the ion channel. The F1 portion consists of five different subunits (α, β, γ, δ, and ε) with a stoichiometry of 3α, 3β, and a single copy of each of the other subunits. The Fo portion contains subunits a, b, and c, with the c-subunits forming a ring structure .

In sodium ion-specific ATP synthases, subunit a (atpB) plays a critical role in sodium ion translocation. During ATP synthesis, sodium ions pass through Fo via subunit a to the c-ring. The resulting rotation of the c-ring is coupled to rotation of the γ subunit within the F1 α3β3 hexamer, providing energy for ATP synthesis at the catalytic sites located at the interfaces between α and β subunits .

Unlike proton-coupled ATP synthases, sodium ion-specific variants can exclusively use Na+ as the coupling ion, as demonstrated in enterobacterial complex I where Na+ is used as the exclusive coupling ion .

What are the established protocols for cloning and expressing recombinant ATP synthase subunit a?

The expression of recombinant ATP synthase subunit a presents significant challenges due to its hydrophobic nature and tendency to aggregate. Based on successful examples in the literature, the following methodological approach is recommended:

  • Gene cloning: The atpB gene should be PCR-amplified from genomic DNA with primers containing appropriate restriction sites. For example, in research with P. modestum, the atpB gene was cloned as a His-tag fusion construct to facilitate purification .

  • Expression vector selection: Vectors with strong, inducible promoters (like pTrc99a) are commonly used. The addition of a purification tag (typically His6 or His8) at either the N- or C-terminus is essential for subsequent purification steps .

  • Host strain selection: E. coli strains like DK8 (Δatp) are often employed as they lack endogenous ATP synthase, preventing contamination with host subunits .

  • Expression conditions: Typical induction uses IPTG (0.5-1.0 mM) at mid-log phase (OD600 of 0.6-0.8), followed by expression at reduced temperatures (25-30°C) for 4-6 hours to minimize inclusion body formation .

  • Membrane preparation: Cells are harvested and disrupted by methods such as French press or sonication, followed by differential centrifugation to isolate the membrane fraction containing the expressed subunit a .

What purification strategies are most effective for recombinant ATP synthase subunit a?

Purification of membrane proteins like subunit a requires specialized approaches:

  • Solubilization: Membranes containing expressed subunit a should be solubilized using appropriate detergents. For ATP synthase components, glycol-diosgenin (GDN, 0.02-1% w/v) and digitonin have shown good results in preserving protein structure and function .

  • Affinity chromatography: For His-tagged constructs, Ni²⁺-charged HisTrap columns are commonly used. Typical conditions include:

    • Equilibration/wash buffer: 20-50 mM Na-phosphate or Tris-HCl, 300-400 mM NaCl, 20 mM imidazole, 0.02% detergent, pH 7.4-7.5

    • Elution buffer: Same as wash, but with 200-500 mM imidazole

  • Size exclusion chromatography: Further purification using Superose 6 or Superdex 200 columns helps separate properly folded protein from aggregates. Recommended buffers contain 20 mM Tris-HCl or HEPES, 100-150 mM NaCl, and detergent at concentrations above the critical micelle concentration .

  • Quality assessment: Purity should be assessed by SDS-PAGE, with functional assessment through reconstitution experiments .

The purification yield is typically in the range of 0.5-2 mg of purified protein per liter of bacterial culture, though this can vary based on expression and solubilization efficiency.

How can functional reconstitution of sodium ion-translocating ATP synthase be achieved?

Functional reconstitution of sodium ion-translocating ATP synthase involves several critical steps:

  • Preparation of proteoliposomes: Purified subunits a, b, and c are mixed at appropriate molar ratios (typically 1:2:10-15, reflecting their stoichiometry in the native complex) with phospholipids (commonly a mixture of phosphatidylcholine and phosphatidic acid) .

  • Reconstitution methods:

    • Detergent dilution: The protein-lipid-detergent mixture is diluted below the critical micelle concentration to form proteoliposomes

    • Bio-Beads method: Detergent is removed using hydrophobic adsorbents

    • Dialysis: Slow removal of detergent through dialysis against detergent-free buffer

  • Buffer composition optimization: For sodium ion-specific ATP synthase reconstitution, buffers typically contain:

    • Internal buffer: 0.5-5 mM KCl, 200-205 mM NaCl, 5-10 mM buffer component (MOPS, Tris, or phosphate), pH 7.0-7.5

    • External buffer: Variable NaCl and KCl concentrations to establish ion gradients

  • Validation of reconstituted complexes: Successful reconstitution is verified through:

    • ²²Na⁺ uptake assays in response to membrane potential

    • ATP synthesis assays

    • ATP hydrolysis measurements

    • DCCD (N,N'-dicyclohexylcarbodiimide) sensitivity testing, as DCCD specifically inhibits ATP synthase activity by binding to c subunits

A functionally reconstituted sodium ion-specific ATP synthase from P. modestum has demonstrated ²²Na⁺ uptake rates of approximately 22 nmol·min⁻¹·mg protein⁻¹ in response to potassium diffusion potential, with the uptake being prevented by DCCD modification of c subunits .

What techniques can be used to measure and characterize sodium ion translocation in ATP synthase?

Several experimental approaches are available for measuring sodium ion translocation:

  • Radioisotope flux measurements:

    • ²²Na⁺ uptake assays in proteoliposomes under various conditions

    • Measurement of ²²Na⁺ out/Na⁺ in-exchange in the absence of membrane potential

  • Potassium diffusion potential experiments:

    • Creating an inside-negative potential by establishing a K⁺ gradient (K⁺ₑₓ > K⁺ᵢₙ) and adding valinomycin

    • Typical conditions: K⁺ᵢₙ = 0.5 mM, K⁺ₑₓ = 10-500 mM to generate different potential magnitudes

  • Sodium gradient experiments:

    • Establishing a sodium concentration gradient (Na⁺ᵢₙ > Na⁺ₑₓ)

    • Typical conditions: Na⁺ᵢₙ = 200-205 mM, Na⁺ₑₓ = 1-15 mM

  • ATP synthesis measurements:

    • Continuous luciferase assay monitoring emitted light in a luminometer

    • Addition of ADP and valinomycin to induce membrane potential and initiate ATP synthesis

    • Experimental setup typically includes: 275 µl proteoliposomes, 20 µl ATP bioluminescence assay reagent, baseline recording (3 min), addition of 0.5 mM ADP and 2 µM valinomycin

  • Ion specificity determination:

    • Comparing effects of different ionophores (e.g., valinomycin for K⁺, monensin for Na⁺, CCCP for H⁺)

    • Testing effects of ion concentration on ATP synthesis rates

For example, in studies with M. ruminantium, ATP synthesis without sodium ions was driven by a membrane potential that was sensitive to cyanide m-chlorophenylhydrazone but not to monensin, while ATP synthesis in the presence of sodium ions was sensitive to monensin, indicating the ability to use either ion depending on conditions .

How does the H⁺/ATP or Na⁺/ATP ratio affect the energetics of ATP synthesis?

The ion/ATP ratio is a critical determinant of the minimum driving force required for ATP synthesis:

  • Relationship between ion/ATP ratio and minimum driving force:

    • The H⁺/ATP or Na⁺/ATP ratio defines the lower limit of proton motive force (pmf) or sodium motive force (smf) required for ATP synthesis

    • This relationship follows the thermodynamic equation: pmf(eq) = n⁻¹ × ΔG'(ATP)/F + 2.3RT/F × n⁻¹ × log(Q), where n is the H⁺/ATP ratio, Q is the reaction quotient ([ATP]/[ADP][Pi]), and F is the Faraday constant

  • Determination of equilibrium driving force (pmf(eq) or smf(eq)):

    • Experimental measurement at various reaction quotient (Q) values

    • Linear relationship between 2.3RT × log(Q) and pmf(eq) with slope equal to the inverse of the H⁺/ATP or Na⁺/ATP ratio

  • Variation in ion/ATP ratio among species:

    • The number of c subunits in the ring (n) varies from 8 to 15 among different organisms

    • This variation results in different coupling ratios (ions transported:ATP generated) ranging from 2.7 to 5.0

    • The ATP/turn of the rotor is consistently 3 in all known ATP synthases, while the H⁺/turn or Na⁺/turn equals the number of c subunits

  • Engineering approaches to modify ion/ATP ratio:

    • Fusion of specific subunits has been shown to effectively modify the H⁺/ATP ratio

    • In one study, the δΔN-α fused F₁F₀ showed ATP synthesis capacity at much lower pmf (68 mV vs. 133 mV for wild-type), suggesting a doubling of the functional H⁺/ATP ratio

The lower the ion/ATP ratio, the lower the minimum driving force required for ATP synthesis, but this also results in lower ATP yield per ion transported. This represents a fundamental trade-off between energy efficiency and the ability to operate under limited driving force conditions.

What is known about the sodium ion binding sites in ATP synthase subunit a?

The sodium ion binding sites in ATP synthase have been characterized through structural studies, biochemical analyses, and site-directed mutagenesis:

  • Location of sodium binding sites:

    • In a structural model of the c₁₁ ring from sodium ion-specific ATP synthases, the Na⁺ binding ligands are located on neighboring c subunits

    • This arrangement results in sodium ions cross-bridging adjacent c subunits, contributing to the remarkable stability of these c-rings

  • Key amino acid residues involved in sodium binding:

    • Glutamate 65 (E65) plays an essential role in cross-bridging subunits

    • Aspartate 2 (D2) has a proposed stabilizing effect as part of the ion bridge

    • The complete Na⁺-binding signature consists of identical amino acid residues in each hairpin of the c subunit

  • Experimental evidence for sodium binding:

    • The heat stability of c₁₁ rings depends on the presence of Na⁺ or Li⁺ ions

    • Higher Li⁺ concentrations (10× higher than Na⁺) are required for equal stability, reflecting the 10× lower binding affinity for Li⁺ than for Na⁺

    • Site-directed mutagenesis has confirmed the essential role of E65 in cross-bridging subunits

  • Intersubunit bridging mechanism:

    • Na⁺ or Li⁺ ions form intersubunit cross-bridges between c subunits

    • This cross-bridging explains the remarkable stability of these c-rings, which can resist even boiling in SDS

    • The binding of alkali ions results in concomitant increase in the stability of the ring structure

Understanding these binding sites has significant implications for the design of inhibitors targeting ATP synthase in pathogenic organisms, as well as for engineering ATP synthases with modified ion specificities or improved stability.

How do hybrid ATP synthases composed of subunits from different species perform?

Hybrid ATP synthases provide valuable insights into structure-function relationships and the modularity of these complexes:

  • Successful hybrid combinations:

    • Functional Fo hybrids have been reconstituted with recombinant subunits a and b from P. modestum and c₁₁ from I. tartaricus

    • These Fo hybrids demonstrated Na⁺ translocation activities indistinguishable from those of P. modestum Fo

  • Compatibility requirements:

    • Subunits from different species can function together if they share similar ion coupling mechanisms

    • The c-ring structure and ion-binding sites must be compatible with the interaction sites on subunit a

  • Experimental validation of hybrid functionality:

    • ²²Na⁺ uptake assays show comparable activity between hybrid and native complexes

    • ATP synthesis capabilities remain intact in properly constructed hybrids

    • DCCD sensitivity is maintained, indicating preserved c-ring structure and function

  • Implications for understanding evolution and specialization:

    • The functionality of hybrid complexes suggests conservation of key structural interfaces despite sequence divergence

    • The ability to create functional hybrids demonstrates the modular nature of ATP synthase components

These findings have practical applications for bioengineering ATP synthases with desired properties, such as enhanced stability or altered ion specificity, by combining optimal components from different species.

What are the latest findings on ATP synthase function under acidic conditions?

Recent research has revealed important insights into ATP synthase function under acidic conditions, which has implications for understanding its role in diseases where mitochondria become acidic:

  • Conformational changes at low pH:

    • A 2024 study by Sharma et al. examined ATP synthase in an acidic state just below neutral on the pH scale, revealing four distinct conformations that occur under acidic conditions

    • Three of these conformations represent distinct stages in the enzyme's reaction cycle, with two unique states not previously described

  • Relevance to pathological conditions:

    • Mitochondria often become acidic in cells affected by diseases such as cancer and cardiac ischemia, as these conditions cause tissues to become oxygen-deficient or hypoxic

    • Understanding ATP synthase function under acidic conditions is therefore crucial for developing therapeutic approaches targeting these conditions

  • Mechanism of action under hypoxic conditions:

    • The study by Sharma et al. illuminates how ATP synthase operates under hypoxic conditions, revealing previously unknown aspects of its working mechanism at low pH

    • This research improves understanding of ATP synthase function in environments that mimic disease states

  • Implications for drug development:

    • ATP synthase is currently a drug target for various infectious diseases, cardiovascular diseases, and cancer

    • For example, bedaquiline (Sirturo) is an FDA-approved drug that targets bacterial ATP synthase for tuberculosis treatment

    • The new understanding of ATP synthase conformations at low pH may guide the development of new therapeutics targeting specific conformational states

These findings represent a significant step toward developing more effective therapeutic strategies for diseases involving ATP synthase dysfunction under acidic conditions.

What are the most common challenges in expressing and purifying recombinant ATP synthase subunit a?

Researchers frequently encounter several obstacles when working with recombinant ATP synthase subunit a:

  • Low expression levels:

    • Problem: Hydrophobic membrane proteins like subunit a often express poorly in heterologous systems

    • Solution: Optimize codon usage for the expression host; use specialized expression vectors with strong promoters; try different E. coli strains like C41(DE3) or C43(DE3) specifically designed for membrane protein expression

  • Protein aggregation and inclusion body formation:

    • Problem: Overexpressed membrane proteins often aggregate in inclusion bodies

    • Solution: Lower expression temperature (16-25°C); reduce inducer concentration; use fusion partners that enhance solubility; optimize induction timing to coincide with mid-log phase growth

  • Inefficient solubilization:

    • Problem: Incomplete extraction from membranes or loss of structural integrity during solubilization

    • Solution: Screen multiple detergents (DDM, Triton X-100, digitonin, GDN); optimize detergent:protein ratios; include glycerol (5-10%) and salt (150-300 mM) in solubilization buffers

  • Purification challenges:

    • Problem: Co-purification of contaminants or loss of protein during purification steps

    • Solution: Use tandem affinity tags; include additional chromatography steps; optimize imidazole concentrations in wash buffers to reduce non-specific binding

  • Stability issues:

    • Problem: Protein degradation or aggregation during storage

    • Solution: Include protease inhibitors throughout purification; store at high protein concentration (>1 mg/ml) with glycerol (10%); avoid freeze-thaw cycles by flash-freezing aliquots in liquid nitrogen

A systematic approach to troubleshooting, coupled with careful optimization at each step, can significantly improve the likelihood of successful expression and purification of functional recombinant ATP synthase subunit a.

How can researchers verify the proper folding and functionality of recombinant ATP synthase subunits?

Verification of proper folding and functionality is crucial before proceeding to complex experiments:

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure composition (expected high α-helical content for subunit a)

    • Size exclusion chromatography to verify monodispersity and absence of aggregation

    • Limited proteolysis to probe for exposed cleavage sites indicating misfolding

  • Functional reconstitution tests:

    • Assembly with partner subunits to form Fo complexes

    • Proteoliposome formation and integrity verification via dynamic light scattering or electron microscopy

    • Ion translocation assays using radioisotopes (²²Na⁺) or fluorescent indicators

  • Specific validation assays:

    • DCCD binding and inhibition assays (DCCD specifically binds to functional c subunits)

    • ATP synthesis measurements in reconstituted vesicles upon establishment of appropriate ion gradients

    • ATP hydrolysis assays for assembled F₁Fo complexes

  • Activity comparison with native complexes:

    • The initial rates of Na⁺ transport for properly folded reconstituted complexes should be in the range of 4.0 μmol·min⁻¹·mg⁻¹ protein for complex I or 0.2 μmol·min⁻¹·mg⁻¹ protein for ATP synthase

    • ATP synthesis rates for properly reconstituted complexes are typically in the range of 99.2 nmol·min⁻¹·mg protein⁻¹

These validation steps are essential to ensure that experimental results obtained with recombinant proteins accurately reflect native ATP synthase behavior.

What are the key unanswered questions about sodium ion-specific ATP synthase?

Despite significant advances, several important questions remain unresolved:

  • Evolutionary origins and advantages:

    • Why have some organisms evolved sodium ion-specific ATP synthases while others use proton-coupled variants?

    • What selective pressures drive the evolution of ion specificity in ATP synthases?

    • How did the transition between H⁺ and Na⁺ specificity occur evolutionarily?

  • Molecular determinants of ion selectivity:

    • Which specific amino acid residues and structural features determine ion selectivity?

    • How does the protein environment tune binding affinity for different ions?

    • Can ion specificity be rationally engineered through targeted mutations?

  • Regulatory mechanisms:

    • How is the activity of sodium ion-specific ATP synthases regulated in vivo?

    • What mechanisms control the expression and assembly of these complexes?

    • Are there specific regulatory proteins that interact with sodium-specific variants?

  • Role in pathogenesis and stress adaptation:

    • How do sodium ion-specific ATP synthases contribute to bacterial survival under extreme conditions?

    • Could these enzymes be targeted for antimicrobial development?

    • What is their role in pathogenic bacteria during infection?

Addressing these questions will require interdisciplinary approaches combining structural biology, biochemistry, molecular genetics, and evolutionary analysis.

What emerging technologies and approaches show promise for advancing research in this field?

Several cutting-edge technologies and approaches are poised to accelerate research on sodium ion-specific ATP synthases:

  • Cryo-electron microscopy (cryo-EM) advances:

    • High-resolution structural determination of intact ATP synthase complexes in different conformational states

    • Time-resolved cryo-EM to capture transitional states during the catalytic cycle

    • Visualization of ion binding sites and conformational changes associated with ion translocation

  • Single-molecule techniques:

    • FRET-based approaches to monitor subunit movements and conformational changes

    • Optical tweezers to measure force generation and mechanical properties

    • Single-molecule electrophysiology to measure ion translocation events

  • Computational approaches:

    • Molecular dynamics simulations of ion translocation through the Fo sector

    • Quantum mechanics/molecular mechanics (QM/MM) methods to model ion coordination and binding energetics

    • Machine learning approaches to predict structure-function relationships and design optimized variants

  • Synthetic biology strategies:

    • Bottom-up assembly of minimal ATP synthases with defined components

    • Creation of hybrid enzymes with novel properties through domain swapping

    • Engineering of ATP synthases with altered ion specificities or improved efficiency

  • In situ structural and functional studies:

    • Correlative light and electron microscopy to study ATP synthases in their native cellular context

    • Cryo-electron tomography to visualize ATP synthases within intact cellular environments

    • Mass spectrometry imaging to map ATP synthase distributions and interactions

These emerging technologies promise to provide unprecedented insights into the structure, function, and regulation of sodium ion-specific ATP synthases, potentially leading to novel applications in biotechnology and medicine.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.