Recombinant ATP synthase subunit a (atp6)

Shipped with Ice Packs
In Stock

Description

Key Features:

PropertyDescription
Genomic OriginMitochondrial DNA (mtDNA), encoded in the MT-ATP6 gene .
Protein StructureMulti-pass membrane protein with conserved residues critical for proton transport .
Functional RoleForms proton channel with subunit c-ring; enables proton motive force-driven ATP synthesis .

Applications in Research

Recombinant ATP6 is used to study ATP synthase assembly, pathogenic mutations, and regulatory mechanisms.

Table 1: Yeast Models for Studying ATP6 Mutations

MutationPhenotypeExperimental Model
aL173R90% reduction in ATP synthesis; impaired proton transport .Saccharomyces cerevisiae
aI123TReduced ATP synthase dimerization; mild oxidative phosphorylation defects .ρ⁻ atp6 mutants
aY232HDisrupted F₀-F₁ assembly; increased free F₁ subunits .Synthetic ρ⁻ strains

Key Findings:

  • Translation Regulation: F₁ subunits activate translation of ATP6 and ATP8 (subunit 8) by stabilizing mRNA or interacting with ribosomes .

  • Assembly-Dependent Feedback: Mutations in ATP6 disrupt assembly, triggering compensatory translation of stator subunits (e.g., subunit h) .

Clinical Relevance

Pathogenic mutations in MT-ATP6 are linked to mitochondrial disorders, including neuropathy, ataxia, and retinitis pigmentosa (NARP) and mitochondrial encephalopathies .

Table 2: Clinically Relevant ATP6 Mutations

MutationDiseaseFunctional Impact
m.8993T>GNARP syndrome, Leigh syndromeaL156R substitution; proton leak, reduced ATP synthase activity .
m.9043T>CMitochondrial encephalopathyaI164V; impaired proton translocation .
m.9058A>GProgressive muscle weaknessaT178A; defective ATP synthase dimerization .

Mechanistic Insights:

  • Proton Leakage: Mutations (e.g., m.8993T>G) compromise proton channel efficiency, reducing ATP production .

  • Assembly Defects: Missense mutations (e.g., aY212H) destabilize F₀-F₁ interactions, leading to free F₁ particles .

Production and Challenges

Recombinant ATP6 is produced via heterologous expression systems (e.g., E. coli, yeast), followed by purification and structural analysis.

Table 3: Production Challenges

ChallengeSolution
Low SolubilityUse of chaperones (e.g., Atp11p, Atp12p) to assist folding .
Incorrect Post-Translational ModificationsExpression in eukaryotic systems (e.g., insect cells, yeast) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your desired format in the order notes, and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. We recommend contacting your local distributor for specific delivery time information.
Note: Our proteins are shipped standard with blue ice packs. Should you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, it is recommended to briefly centrifuge the vial prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoted for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms exhibit a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. To maintain optimal protein integrity, avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is finalized during the production process. If you have a specific tag preference, please inform us, and we will prioritize fulfilling your request.
Synonyms
atp6; ATP synthase subunit a; F-ATPase protein 6; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-78
Protein Length
full length protein
Species
Aspergillus amstelodami
Target Names
atp6
Target Protein Sequence
MGNLNFVLSPLDQFEVRDLLSINANLLGNFHLSLTNIGLYLTIGIFLILTYSLLATNNNK IIPNNWSISQESIYATVH
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) is responsible for ATP production from ADP in the presence of a proton gradient across the membrane, generated by electron transport complexes within the respiratory chain. F-type ATPases consist of two structural domains: F(1), containing the extramembraneous catalytic core, and F(0), containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. As a key component of the proton channel, it may directly contribute to the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of ATP synthase subunit a (ATP6)?

ATP synthase subunit a (ATP6) is an integral component of the F₀ domain of the mitochondrial ATP synthase complex. This complex is organized into a hydrophobic membrane domain (F₀) that transports protons through the membrane, and a hydrophilic domain (F₁) where ATP synthesis occurs. Within the F₀ domain, subunit a forms an integral proton channel together with an oligomeric ring of 10 subunits 9 (the 9₁₀-ring) . During proton translocation, the 9₁₀-ring rotates, and this rotation is mechanically coupled to the γ-stalk in the F₁ region, which drives the catalysis of ATP synthesis at each of the three α-β subunit interfaces in F₁ .

The yeast mitochondrial ATP synthase consists of 28 subunits of 17 different types, with subunits 6, 8, and 9 being encoded by mitochondrial genes, while the remaining 14 have nuclear genetic origin . This dual genetic origin presents unique challenges for coordinating the synthesis and assembly of all components in the proper stoichiometry. The ATP synthase complex is a remarkable example of a molecular machine that couples proton gradient-driven rotation to chemical catalysis.

How does ATP6 contribute to ATP synthesis in mitochondria?

ATP6 plays a fundamental role in the chemiosmotic coupling mechanism of ATP synthesis. It forms the stationary component of the proton channel that works in conjunction with the rotating c-ring (composed of subunit 9 monomers). As protons flow through this channel from the intermembrane space to the matrix, following the electrochemical gradient established by the respiratory chain, they drive the rotation of the c-ring .

The rotation of the c-ring is coupled to the rotation of the γ-stalk in the F₁ region, where subunit γ functions as a shaft inside the α₃β₃ head. This γ-rotation drives the catalysis of ADP + Pi → ATP at each of the three catalytic sites at the α-β interfaces in F₁. This cyclical sequence of rotation, translocation, and catalysis produces 3 ATP molecules for every n protons (where n equals the number of c-subunits in the ring) that pass from the lumen to the stroma in chloroplasts or from the intermembrane space to the matrix in mitochondria .

The coupling ratio (ions transported : ATP generated) varies among organisms from 3.3 to 5.0, depending on the number of c-subunits per ring, while the number of ATP generated per c-ring rotation remains constant at 3 in all known ATP synthases .

What are the challenges in producing recombinant ATP6?

Producing recombinant ATP6 presents several significant challenges due to its highly hydrophobic nature as an integral membrane protein. Unlike soluble proteins, membrane proteins like ATP6 require a lipid environment for proper folding and function. When expressed recombinantly, they often form insoluble aggregates or inclusion bodies, which can be difficult to refold into functional structures .

Another major challenge is the co-translational insertion requirement. In the native environment, ATP6 is synthesized inside mitochondria and requires co-translational insertion into the mitochondrial inner membrane through mechanisms involving proteins like OXA1L . Replicating this process in heterologous expression systems is challenging. If not properly inserted into a membrane during synthesis, ATP6 can misfold, triggering quality control mechanisms such as degradation by the AFG3L2 protease complex .

Additionally, ATP6 normally functions as part of a multi-subunit complex, interacting with other ATP synthase components. Expressing it in isolation may not yield a protein with the correct conformation or functional properties, as it lacks these interaction partners that might be necessary for proper folding or stability .

What expression systems are suitable for recombinant ATP6 production?

Several expression systems have been explored for recombinant production of hydrophobic membrane proteins like ATP6, each with distinct advantages. Bacterial expression in Escherichia coli represents a well-established approach, particularly when using fusion partners to improve solubility. For instance, the ATP synthase c-subunit from spinach chloroplasts has been successfully expressed in E. coli as a fusion with maltose binding protein (MBP), which enhances solubility and facilitates purification .

When considering expression strategies for ATP6, researchers might adopt similar approaches to those used for the c-subunit, given their comparable hydrophobicity and membrane integration. The fusion protein approach allows for: (1) improved protein solubility during expression, (2) enhanced translation efficiency, and (3) simplified purification through affinity chromatography using the fusion partner .

For more native-like expression, yeast systems such as Saccharomyces cerevisiae or Pichia pastoris offer eukaryotic processing machinery and membrane environments more similar to those in which ATP6 naturally functions. These systems are particularly valuable when post-translational modifications or specific membrane insertion mechanisms are critical for proper folding and function. When expressing mitochondrial proteins, yeast expression can sometimes be advantageous as it provides a more compatible membrane environment and processing machinery .

How can researchers purify and verify recombinant ATP6?

Purification of recombinant ATP6 requires specialized strategies due to its hydrophobic nature. A multi-step approach typically begins with detergent solubilization of membranes to extract the protein. Selection of an appropriate detergent is critical—mild detergents like n-dodecyl β-D-maltoside (DDM) or digitonin often preserve protein structure and function better than harsh detergents like SDS .

For fusion proteins such as MBP-tagged constructs, affinity chromatography provides an initial purification step. Following affinity purification, size exclusion chromatography can separate properly folded protein from aggregates. If the protein was expressed with a cleavable tag, protease treatment (e.g., with TEV protease) followed by a second affinity or ion-exchange step can yield the isolated target protein .

Verification of purified ATP6 structure and function involves multiple analytical techniques. Circular dichroism spectroscopy can confirm the expected α-helical secondary structure, as demonstrated with the c-subunit of chloroplast ATP synthase . Functional verification might involve reconstitution into liposomes and assessment of proton translocation activity. Native PAGE analysis can identify protein-detergent complexes of the expected size, while mass spectrometry confirms the protein identity and integrity. Thermal stability assays using differential scanning fluorimetry can provide information about protein folding and stability under various conditions .

What techniques are available for studying ATP6 assembly into the ATP synthase complex?

Investigating ATP6 assembly into the ATP synthase complex requires approaches that can capture assembly intermediates and protein-protein interactions within the membrane environment. Blue native polyacrylamide gel electrophoresis (BN-PAGE) provides a powerful tool for analyzing intact membrane protein complexes and subcomplexes. This technique can identify assembly intermediates containing ATP6 and track their progression into the complete ATP synthase complex .

Pulse-chase labeling experiments using radiolabeled amino acids allow researchers to follow the kinetics of ATP6 synthesis and assembly. This approach has revealed that the rate of translation of ATP6 is enhanced in strains with mutations leading to specific defects in the assembly of this protein, suggesting feedback regulation mechanisms .

Co-immunoprecipitation using antibodies against ATP6 or other ATP synthase subunits can identify interaction partners during assembly. For instance, studies have shown that Atp10 associates in a physical complex with newly translated subunit 6 and promotes its favorable interaction with the 9₁₀-ring . Crosslinking followed by mass spectrometry (XL-MS) offers another approach to capture transient interactions during assembly, providing spatial constraints for interaction modeling .

Recent advances in cryo-electron microscopy (cryo-EM) have enabled the visualization of ATP synthase complexes at near-atomic resolution, including the positioning of ATP6 relative to other subunits. This technique could potentially be adapted to visualize assembly intermediates if they can be biochemically isolated in sufficient quantity and purity .

How can recombinant ATP6 be used to study pathogenic variants?

Recombinant expression systems offer powerful platforms for investigating the functional consequences of ATP6 pathogenic variants associated with mitochondrial disorders. By introducing specific mutations into expression constructs, researchers can produce variant forms of ATP6 for detailed biochemical and structural characterization . This approach allows for the isolation of effects specific to ATP6, separate from other potential mitochondrial defects that might be present in patient-derived samples.

Studies on pathogenic variants have revealed that defects in the OXA1L-mediated insertion of MT-ATP6 nascent chains into the mitochondrial inner membrane are rapidly resolved by the AFG3L2 protease complex . Different pathogenic variants exhibit distinct effects on this quality control process, contributing to the molecular understanding of disease mechanisms. For example, some variants may primarily affect protein stability, while others might impair interactions with other subunits or disrupt proton translocation function .

Recombinant systems also enable the development of high-throughput screens for small molecules that might rescue function of specific variants, potentially leading to targeted therapeutic approaches. When combined with structural information, such studies can provide insights into structure-function relationships and potentially reveal the molecular basis for the clinical heterogeneity observed in ATP6-associated disorders .

What insights have emerged from studying ATP6 translation regulation?

Research into ATP6 translation has revealed sophisticated regulatory mechanisms that coordinate the production of mitochondrially-encoded subunits with their nuclear-encoded assembly partners. Studies show that the rate of translation of ATP6 is enhanced in strains with specific defects in the assembly of this protein, suggesting a feedback mechanism that responds to the assembly state of the ATP synthase complex .

These translation modifications involve assembly intermediates interacting with ATP6 within the final enzyme and cis-regulatory sequences that control gene expression in the organelle. This suggests that ATP6 is part of an assembly-dependent feedback loop that differs from previously reported regulatory models for this protein . Quantitative PCR analysis of ATP6 transcript levels compared to other mitochondrial genes like COX3, CYTB, and ND1 can reveal transcript-specific regulation mechanisms .

Interestingly, the traditional view that the 9₁₀-ring forms separately, independently of other ATP synthase components, has been challenged by findings suggesting that the assembly of ATP6 and the c-ring may be coordinated . This coordination would ensure the proper stoichiometric relationship between these key components of the proton channel and prevent the accumulation of potentially harmful assembly intermediates.

How does ATP6 recombination contribute to mitochondrial genome diversity?

Mitochondrial DNA recombination, including at the ATP6 locus, represents an important mechanism contributing to genetic diversity and potentially adaptation. Direct evidence for homologous recombination in Drosophila mtDNA has opened up possibilities for recombinational mapping of functions on the mitochondrial genome . Studies have identified recombinant genomes containing ATP6 sequences from different parental genomes, demonstrating that recombination can occur at this locus.

In one study, researchers isolated a recombinant genome that was a ~60%/40% chimera of the T300I ATP6 and mt:ND2 + del1 mt:CoI parental genomes . This recombinant genome complemented the temperature-sensitive defect of a double mutant, demonstrating functional significance of the recombination event. Over subsequent generations, a multigenerational selection for function caused an increase in the proportion of the recombinant genome, showing that it had lost the transmission disadvantage of one parental genome .

Further research has isolated additional recombinant genomes, including one containing a much smaller segment of ATP6 extending from mt671 to mt5978, with the rest of the coding region belonging to the mt:ND2 + del1 mt:CoI genome . These findings highlight the potential for natural recombination events to generate novel combinations of functional elements in the mitochondrial genome, which may contribute to adaptability and fitness under different environmental conditions.

What are effective strategies for studying ATP6 mutations and their functional consequences?

Developing effective strategies to study ATP6 mutations requires a multi-faceted approach that combines molecular, cellular, and biochemical techniques. Site-directed mutagenesis in recombinant expression constructs provides a controlled way to introduce specific mutations and study their effects on protein expression, stability, and function. This approach allows direct comparison between wild-type and mutant proteins under identical conditions .

Yeast models offer a powerful system for studying ATP6 mutations, as the mitochondrial genetic system in Saccharomyces cerevisiae is amenable to manipulation. Heteroplasmic lines containing mixed populations of wild-type and mutant mitochondrial genomes can reveal competition effects and functional consequences under different selective pressures . Temperature-sensitive mutants provide a useful tool for studying conditional phenotypes, allowing researchers to control the manifestation of functional defects .

Another approach involves studying the quality control mechanisms that respond to ATP6 synthesis and folding defects. Research has shown that defects in the OXA1L-mediated insertion of MT-ATP6 nascent chains into the mitochondrial inner membrane are rapidly resolved by the AFG3L2 protease complex . By manipulating these quality control components (e.g., through siRNA knockdown), researchers can investigate how different mutations engage with cellular quality control mechanisms.

For functional analyses, ATP hydrolysis and synthesis assays using isolated mitochondria or reconstituted systems can quantify the impact of mutations on enzymatic activity. Proton leak measurements can specifically assess the integrity of the proton channel formed by ATP6 and the c-ring. These functional studies can be complemented with structural analyses using techniques like cryo-EM to visualize changes in protein conformation or complex assembly .

How can researchers investigate the stoichiometry and assembly of ATP synthase components?

ATP synthase components exhibit variable stoichiometry across species, particularly in the c-ring, which affects the bioenergetic efficiency of the enzyme. Investigating this stoichiometry and the assembly process requires specialized techniques that can analyze intact complexes and their subcomponents.

Blue native polyacrylamide gel electrophoresis (BN-PAGE) represents a cornerstone technique for analyzing intact membrane protein complexes. By solubilizing membranes with mild detergents and separating complexes under native conditions, researchers can identify assembly intermediates and assess the completeness of complex formation . Two-dimensional gel electrophoresis, combining BN-PAGE with SDS-PAGE, allows for the identification of individual subunits within each complex or subcomplex.

Mass spectrometry offers powerful approaches for determining subunit stoichiometry. Quantitative proteomics using stable isotope labeling or label-free quantification can measure the relative abundances of different subunits within purified complexes. Cross-linking mass spectrometry (XL-MS) provides information about spatial relationships between subunits, helping to validate assembly models .

For specific investigation of the c-ring stoichiometry, atomic force microscopy (AFM) and electron microscopy have been successfully applied to directly visualize and count the number of c-subunits in the ring from different organisms. These studies have revealed that the number of c-subunits per ring (n) is organism-dependent, ranging from c₁₀ to c₁₅, which directly affects the coupling ratio (ions transported : ATP generated) from 3.3 to 5.0 .

Fluorescence microscopy approaches using tagged subunits can track the assembly process in living cells. Pulse-chase labeling with radioactive amino acids allows for time-resolved analysis of protein synthesis and assembly into complexes. These approaches have revealed that the rate of translation of ATP6 is enhanced in strains with mutations leading to specific defects in its assembly, suggesting feedback regulation mechanisms .

Comparative Analysis of c-Ring Stoichiometry Across Species

Organismc-subunit Ring StoichiometryCoupling Ratio (H⁺:ATP)Reference
Various organismsc₁₀ to c₁₅3.3 to 5.0
Spinach chloroplastVariable (study target)-

This table highlights the known variability in c-ring stoichiometry across different species, which directly impacts the bioenergetic efficiency of ATP synthase. The coupling ratio represents the number of protons required to synthesize one ATP molecule .

ATP Synthase Subunit Composition and Genetic Origin

SubunitGenetic OriginFunctionReference
Subunit 6 (a)Mitochondrial (ATP6)Forms proton channel with c-ring
Subunit 8Mitochondrial (ATP8)Stabilizes proton channel
Subunit 9 (c)Mitochondrial (ATP9)Forms c₁₀-ring for proton translocation
Other 14 subunitsNuclearVarious structural and functional roles

The ATP synthase complex demonstrates the challenge of coordinating protein synthesis from two genetic compartments (nuclear and mitochondrial) to achieve the correct stoichiometry for functional complex assembly .

Assembly Factors for ATP Synthase Components

Assembly FactorTarget SubunitFunctionReference
Atp10Subunit 6Associates with newly translated subunit 6; promotes interaction with c-ring
Atp23Subunit 6Protease that cleaves first 10 amino acids of nascent subunit 6
Atp25 (32 kDa N-terminal fragment)Subunit 9Chaperones oligomerization of c₁₀-ring
OXA1LSubunit 6Mediates insertion of nascent chains into inner membrane
AFG3L2 protease complexSubunit 6Quality control; resolves defects in membrane insertion

This table summarizes key assembly factors identified for ATP synthase components, highlighting the complex machinery required for proper biogenesis of this essential energy-producing complex .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.