Recombinant ATP synthase subunit b, chloroplastic (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; ATP synthase subunit b, chloroplastic; ATP synthase F(0 sector subunit b; ATPase subunit I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-184
Protein Length
full length protein
Species
Amborella trichopoda
Target Names
atpF
Target Protein Sequence
MKNVTDSFVSLGHWPSAGSFGFNTDIFATNPINLSVVLGVLIFFGKGVLSDLLDNRKQRI LSTIRNSEELRGGAIEQLEKARARLRKVEIEADEFRVNGYSEIEREKSNLINAAYENLER LENYKNESIHFEQQRAMNQVRQRVFQQALQGALETLNSYLNSELHLRTISANIGMLGTMK NITD
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the extramembranous catalytic F1 domain and the membrane-bound proton channel F0 domain, connected by a central and a peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits.

This protein is a component of the F0 channel, specifically within the peripheral stalk, linking F1 and F0.

Database Links

KEGG: atr:2546499

Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is the structural and functional role of ATP synthase subunit b (atpF) in chloroplasts?

ATP synthase subunit b (atpF) forms part of the peripheral stalk in the F₀ component of the chloroplast ATP synthase complex. This peripheral stalk connects the membrane-embedded F₀ proton channel to the catalytic F₁ domain. The protein plays a critical role in maintaining the structural integrity of the ATP synthase complex and enabling efficient energy conversion during photosynthesis .

The atpF protein forms part of a multisubunit enzyme with a distinct architecture:

DomainComponentsFunction
F₁α₃, β₃, γ₁, δ₁, ε₁Catalytic core for ATP synthesis
F₀a₁, b₁, b'₁, c₁₀₋₁₄Membrane proton channel
Peripheral stalkb, b', δConnects F₁ to F₀, prevents rotation of F₁ during catalysis

During ATP synthesis, the peripheral stalk (including atpF) serves as a stationary element that prevents the α₃β₃ hexamer from rotating with the central stalk during proton translocation, thereby enabling the rotary mechanism essential for ATP production .

How does recombinant atpF differ from native atpF in functional studies?

Recombinant atpF proteins typically contain additional elements such as affinity tags (often His-tags) to facilitate purification and detection . These modifications can potentially affect protein folding, stability, and interaction with other ATP synthase subunits.

When using recombinant atpF in functional studies, researchers should consider:

  • Tag position effects: N-terminal versus C-terminal tags may differentially impact function

  • Expression system influence: E. coli-expressed atpF may lack post-translational modifications present in chloroplasts

  • Protein solubility challenges: As a membrane protein component, recombinant atpF may require detergents or lipid reconstitution for proper folding

Control experiments comparing tagged and untagged versions, as well as native and recombinant proteins, are essential to validate functional equivalence .

How can structure-function relationships in atpF be investigated using site-directed mutagenesis?

Site-directed mutagenesis of recombinant atpF provides valuable insights into structure-function relationships within ATP synthase. Research has demonstrated that specific amino acid modifications can significantly impact ATP synthesis without affecting ATPase activity.

A methodological approach includes:

  • Identifying conserved residues through sequence alignment across species

  • Generating point mutations (substitutions, insertions, or deletions)

  • Expressing mutant proteins in appropriate hosts (E. coli or chloroplast transformation systems)

  • Assessing functional impacts through:

    • ATP synthesis/hydrolysis assays

    • Protein-protein interaction studies

    • Structural stability analyses

For example, research has shown that enlarging the side chain of chloroplast β subunit residue 63 from Cys to Trp blocked ATP synthesis in vivo without significantly impairing ATPase activity or ADP binding in vitro . Similar approaches can be applied to atpF to investigate critical residues involved in peripheral stalk assembly or interactions with other ATP synthase components.

What approaches are effective for studying atpF interactions with other ATP synthase subunits?

Multiple complementary techniques can elucidate atpF interactions within the ATP synthase complex:

TechniqueApplicationAdvantagesLimitations
Co-immunoprecipitationIdentifying physical interactionsPreserves native interactionsMay detect indirect interactions
Yeast two-hybridScreening for direct interactionsHigh-throughput capabilityMay produce false positives
Crosslinking-MSMapping interaction interfacesProvides spatial informationTechnical complexity
FRET analysisDynamic interaction studiesReal-time observations possibleRequires fluorescent labeling
Cryo-EMStructural determinationHigh-resolution structural dataRequires specialized equipment

When designing interaction studies, researchers should consider that atpF forms part of a peripheral stalk that includes both nuclear-encoded and chloroplast-encoded subunits. Studies in Chlamydomonas reinhardtii have shown that mutations affecting either atpF or ATPG (encoding subunit b') prevent ATP synthase accumulation, highlighting their interdependence .

What expression systems are optimal for producing functional recombinant atpF protein?

The choice of expression system significantly impacts the yield and functionality of recombinant atpF protein:

Expression SystemAdvantagesDisadvantagesOptimization Strategies
E. coliHigh yield, well-established protocolsLacks chloroplast-specific modificationsUse of specialized strains (C41/C43), low temperature induction
Yeast (S. cerevisiae, P. pastoris)Post-translational modificationsLower yield than E. coliCodon optimization, inducible promoters
Chloroplast transformationNative environmentTechnical complexitySpecies-specific optimization
Cell-free systemsAvoids toxicity issues, rapidHigher costMembrane protein-specific supplements

For membrane protein components like atpF, common challenges include:

  • Protein misfolding and aggregation

  • Toxicity to host cells

  • Low solubility without appropriate detergents

Successful expression strategies often employ:

  • Fusion partners to enhance solubility (MBP, SUMO)

  • Reduced induction temperature (16-20°C)

  • Specialized E. coli strains designed for membrane proteins

  • Detergent screening for optimal solubilization

What purification strategies yield the highest purity and activity of recombinant atpF?

Given atpF's membrane association, purification requires specialized approaches:

  • Solubilization optimization:

    • Screen detergents (DDM, LDAO, Triton X-100) for efficient extraction

    • Consider lipid:protein ratios to maintain native-like environment

  • Affinity chromatography:

    • His-tagged atpF can be purified using Ni-NTA resins

    • Washing buffers should maintain detergent above critical micelle concentration

    • Elution with imidazole gradient preserves protein structure

  • Additional purification steps:

    • Size exclusion chromatography separates monomeric from aggregated protein

    • Ion exchange chromatography can remove remaining contaminants

    • Avoid harsh conditions that may denature the protein

  • Quality assessment:

    • Purity: SDS-PAGE, western blotting

    • Structure: Circular dichroism to verify secondary structure integrity

    • Function: Reconstitution into liposomes for functional assays

Recommended storage conditions include 50% glycerol at -80°C to prevent freeze-thaw damage, as protein stability is enhanced in this environment .

How can researchers address low expression yields of recombinant atpF?

Low expression yields of atpF are common due to its membrane protein nature. Methodological solutions include:

  • Codon optimization:

    • Adapt codons to match tRNA abundance in expression host

    • Remove rare codons that may cause ribosomal stalling

  • Expression vector modifications:

    • Test different promoter strengths

    • Optimize ribosome binding sites

    • Include chaperone co-expression systems

  • Induction conditions:

    • Reduce IPTG concentration (0.1-0.5 mM range)

    • Lower growth temperature (16-25°C)

    • Extend induction time (overnight or longer)

  • Alternative strains:

    • C41/C43 strains specifically developed for membrane proteins

    • BL21(DE3) pLysS to reduce leaky expression

    • Rosetta strains to supply rare tRNAs

When traditional approaches fail, fusion with highly expressed partners like maltose-binding protein (MBP) can dramatically improve yields while maintaining the option to remove the fusion tag later through protease cleavage sites .

What strategies can overcome protein aggregation of recombinant atpF during purification?

Protein aggregation is a significant challenge when working with membrane proteins like atpF:

  • Optimized solubilization:

    • Systematic screening of detergent type and concentration

    • Consider mixed micelle systems (primary/secondary detergents)

    • Include lipids during purification to stabilize native structure

  • Buffer optimization:

    • Adjust pH to match protein's theoretical isoelectric point

    • Include stabilizing agents (glycerol 5-10%, sucrose)

    • Add reducing agents to prevent disulfide formation

  • Processing conditions:

    • Maintain samples at 4°C throughout purification

    • Avoid freeze-thaw cycles

    • Consider filtration rather than centrifugation for certain steps

  • Refolding approaches:

    • On-column refolding during affinity purification

    • Dialysis-based gradual detergent exchange

    • Reconstitution into nanodiscs or liposomes

Analytical techniques like dynamic light scattering can help monitor aggregation states during optimization of purification conditions .

How should researchers interpret contradictory findings in atpF mutant studies?

Contradictory findings in atpF research may arise from several factors:

  • Species-specific differences:

    • Compare sequences between species to identify conservation patterns

    • Note that algal, plant, and bacterial ATP synthases have distinct features

    • Account for evolutionary adaptations in different photosynthetic organisms

  • Experimental system variations:

    • In vitro vs. in vivo studies may yield different results

    • Recombinant vs. native protein behavior can differ

    • Heterologous expression may lack essential interacting partners

  • Mutation context:

    • Different mutations in the same protein may have compensatory effects

    • The same mutation may have different effects depending on genetic background

    • Consider the three-dimensional context of mutations using structural models

  • Technical considerations:

    • Assay sensitivities vary between laboratories

    • Different detection methods may measure different aspects of function

    • Expression levels of mutant proteins should be quantified

Research in Chlamydomonas reinhardtii has shown that knockout mutations in ATPG (encoding subunit b') completely prevent ATP synthase accumulation, while knockdown mutations allow small amounts of functional ATP synthase to accumulate . This demonstrates the importance of quantitative analysis when interpreting mutation effects.

What bioinformatic approaches best support structural and functional analysis of atpF across species?

Comprehensive bioinformatic analysis of atpF can reveal important evolutionary and functional insights:

  • Sequence analysis pipeline:

    • Multiple sequence alignment using MUSCLE or CLUSTAL

    • Phylogenetic tree construction to trace evolutionary relationships

    • Conservation scoring to identify functionally critical residues

    • Hydropathy analysis to predict membrane-spanning regions

  • Structure prediction methods:

    • Secondary structure prediction (PSIPRED, JPred)

    • Homology modeling based on related structures

    • Ab initio modeling for unique regions

    • Molecular dynamics simulations to test stability

  • Protein-protein interaction prediction:

    • Interface prediction algorithms

    • Coevolution analysis to identify interacting surfaces

    • Docking studies with known ATP synthase components

  • Integrated analysis approach:

Analysis LevelTools/MethodsInsights Provided
Primary sequenceBLAST, Pfam, InterProDomain architecture, conservation
Secondary structurePSIPRED, JPredHelical regions, topology
Tertiary structureAlphaFold, I-TASSER3D conformation, interaction surfaces
Quaternary structureMolecular docking, CryoEM fittingAssembly within ATP synthase complex

Comparative analysis between the atpF proteins of different species has revealed that while the protein is generally conserved in structure, specific adaptations exist that may reflect environmental pressures or evolutionary divergence in the photosynthetic apparatus .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.