Recombinant ATP synthase subunit b', organellar chromatophore (atpG)

Shipped with Ice Packs
In Stock

Description

Structure and Function

Mycobacterium smegmatis ATP synthase structure was determined by electron cryomicroscopy. This revealed significant attributes crucial for understanding the mechanism and regulation of the mycobacterial enzyme .

Key structural and functional aspects include:

  • Substates in Catalytic Cycle Analysis reveals not only three main states in the catalytic cycle, but also eight substates, portraying structural and mechanistic changes during a 360° catalytic cycle .

  • Auto-inhibition Mechanism A mechanism of auto-inhibition of ATP hydrolysis involves the engagement of the C-terminal region of an $$\alpha$$-subunit in a loop in the $$\gamma$$-subunit and a "fail-safe" mechanism involving the b'-subunit in the peripheral stalk that enhances engagement .

  • Fused b$$\delta$$-Subunit The fused b$$\delta$$-subunit contains a duplicated domain in its N-terminal region where the two copies of the domain participate in similar modes of attachment of the two of three N-terminal regions of the $$\alpha$$-subunits .

  • Proton Delivery The transmembrane proton-motive force that provides the energy to drive the rotary mechanism is delivered directly and tangentially to the rotor via a Grotthuss water chain in a polar L-shaped tunnel .

Role in Metabolism Regulation

The ATP synthase $$\beta$$ subunit and other components of the enzymatic F1 portion of the synthase respond to, and regulate, metabolic flexibility . The ATP synthase F1 subunits work in a complex with regulators, including antiapoptotic proteins such as Bcl-xL .

  • In mouse neurons with decreased levels of F1 components including OSCP and the $$\beta$$ subunit, mitochondrial membrane potential is depolarized, accompanied by increased oxidative stress, early PT, low ATP levels and decreased synaptic function .

  • The anti-death protein Bcl-xL binds to the $$\beta$$ subunit of the ATP synthase and enhances mitochondrial ATP production efficiency, leading to enhanced synapse formation and enhanced synaptic transmission as well as increased localization of mitochondria to synaptic sites through activation of mitochondrial fission .

  • DJ-1 binds to the $$\beta$$ subunit, increases ATPase activity and the level of ATP in cells, and decreases oxygen uptake, enhancing inner membrane coupling, and metabolic efficiency of oxidative phosphorylation .

Involvement in Disease

Malfunction of ATP synthase has been linked to various pathological conditions .

  • Mutation or loss of DJ-1 causes a decrease in ATP synthase enzymatic rate, a decrease in cellular ATP levels, loss of mitochondrial inner membrane potential and development of a large leak in the mitochondrial inner membrane. These findings are accompanied by decreased protein levels of ATP synthase $$\beta$$ subunit and a decrease in the ratio of $$\beta$$ subunit mRNA and protein to those of c-subunit .

  • Enterostatin, a pentapeptide, binds to the $$\beta$$ subunit in ATP synthase and inhibits ATP synthesis .

Role in Cellular Uptake

The $$\beta$$-subunit of ATP synthase is involved in cellular uptake and resecretion of apoA-I. ApoA-I recycling can be blocked by an anti-ATP synthase $$\beta$$-subunit antibody, suggesting the involvement of the $$\beta$$-subunit of ATP synthase in apoA-I recycling . Cell surface expression of ATP synthase has been reported for several cell lines, and the $$\beta$$-ATP-synthase has been shown to bind to several alpha helical proteins .

Expression in Tumors

Ectopic ATPB in tumor cellular membrane was identified as the non-small cell lung cancer (NSCLC) associated antigen . Down-regulation of the bioenergetic activity of mitochondria in human tumors is exerted by the ATP synthase subunit $$\beta$$ .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF2; atpG; PCC_0202; ATP synthase subunit b', organellar chromatophore; ATP synthase F(0 sector subunit b'; ATPase subunit II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Paulinella chromatophora
Target Names
atpG
Target Protein Sequence
MTSWLLLAEAGVPEGGLFDLDATLPLMAIQVVFLTFILNAIFFRPIGRTVEERENYVASS RADAKQKLAQVERLEANLTEQLRGARKQSQTVIAEAEEEVNRLYQEALRMAQAEANNIRE SSRREIEIQKAAAIKSLQGDVDRLSNLIVDRLLASR
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F(1) catalytic core (extramembraneous) and the F(0) membrane proton channel, connected by a central and peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled to proton translocation via the central stalk's rotary mechanism. The b'-subunit, a component of the F(0) channel and part of the peripheral stalk, links F(1) and F(0). In plants and photosynthetic bacteria, b' is a diverged and duplicated form of the b subunit.
Protein Families
ATPase B chain family
Subcellular Location
Plastid, organellar chromatophore thylakoid membrane; Single-pass membrane protein.

Q&A

What is the structural role of subunit b in the ATP synthase complex?

Subunit b serves as a critical component of the peripheral stalk in the F1F0 ATP synthase complex. In prokaryotes like Escherichia coli, it exists as a parallel homodimer of identical b subunits that forms part of the peripheral stalk connecting the F1 catalytic domain to the F0 membrane sector . The peripheral stalk plays a crucial role in stabilizing the c-ring/F1 complex and maintaining the structural integrity of the ATP synthase .

In humans and other mammals, the b subunit (also called ATP5PB or ATP5F1) is encoded by a nuclear gene and constitutes part of the proton channel in the membrane-spanning F0 component . It functions alongside other subunits including a, c, d, e, f, g, F6, and A6L to form the complete proton channel .

How do chromatophores function as ATP-producing systems in research applications?

Chromatophores are closed vesicular structures derived from photosynthetic bacteria such as Rhodobacter sphaeroides that contain complete photophosphorylation machinery. They function as efficient light-driven ATP synthesis systems with the following characteristics:

  • They contain properly oriented ATP synthase complexes (1.6 ATP synthases per chromatophore on average)

  • All ATP synthase complexes are outward-oriented, with F1 domains pointing outward, allowing ATP production in the external solution

  • They achieve high ATP production rates (approximately 80-100 ATP molecules per second per ATP synthase)

  • They contain a complete electron transport chain including bc1 complex, reaction centers, and sufficient ubiquinone/ubiquinol pool in the membrane

When used in research applications, chromatophores can be encapsulated inside giant lipid vesicles to create artificial protocells capable of autonomous energy production, performing 10-18 times better than other ATP synthase-bearing artificial organelles .

What is Factor B and how does it relate to ATP synthase function?

Factor B is a subunit of mammalian ATP synthase whose existence was initially controversial but has now been confirmed. Key characteristics include:

  • Mature human Factor B has 175 amino acids and a molecular mass of 20,341 Da

  • It is water-soluble and monomeric in structure

  • It is sensitive to monothiol- and especially dithiol-modifying reagents, with cysteine residues Cys-92 and Cys-94 being likely reaction sites

  • The human Factor B gene is located on chromosome 14q21.3 and consists of 5 exons

Functionally, Factor B appears to help maintain high mitochondrial membrane potential (Δψm) by blocking a latent proton-translocating pathway, thus preventing proton leakage and favoring ATP synthase activity . When added to bovine submitochondrial particles depleted of their Factor B, it restores the energy coupling activity of the ATP synthase complexes .

What methods are effective for expressing and purifying recombinant ATP synthase subunit b?

Based on successful approaches documented in the literature, researchers should consider the following methods:

Expression Systems:

  • Yeast expression systems have been successfully used for recombinant human ATP5F1B (ATP synthase subunit beta)

  • E. coli has been used effectively for expressing b subunits with mutations for structure-function studies

Purification Strategy:

  • Add an N-terminal 6xHis-tag to facilitate purification via affinity chromatography

  • Express the mature protein (without mitochondrial targeting sequence) - for human ATP5F1B, amino acids 48-529 have been successfully expressed

  • Purify using nickel affinity chromatography followed by size-exclusion chromatography

  • Verify purity using SDS-PAGE (aim for >90% purity)

Buffer Considerations:

  • For liquid formulations: Tris/PBS-based buffer with 5-50% glycerol

  • For lyophilized preparations: Tris/PBS-based buffer with 6% trehalose at pH 8.0 before lyophilization

The resulting recombinant protein should have the expected molecular weight (approximately 54 kDa for human ATP5F1B) .

How can researchers effectively isolate and characterize chromatophores for ATP synthesis experiments?

The isolation and characterization of functional chromatophores from photosynthetic bacteria involves several critical steps:

Isolation Protocol:

  • Culture photosynthetic bacteria (Rhodobacter sphaeroides) under appropriate conditions

  • Harvest cells and disrupt cell membranes under mild conditions to preserve membrane integrity

  • Isolate chromatophores through differential centrifugation

  • Verify intactness of closed vesicular structure through electron microscopy

Characterization Methods:

  • Morphological Assessment: Use cryo-electron microscopy (cryo-EM) to visualize chromatophore structure, size (typically ~50-60 nm in diameter), and ATP synthase orientation

  • Protein Composition Analysis: Verify the presence of key components (ATP synthase, bc1 complex, reaction centers) through proteomic techniques

  • Functional Assessment: Measure ATP production under illumination using luciferase-based ATP detection assays

  • Tomographic Reconstruction: Perform 3D reconstruction to characterize ATP synthase structure (approximately 13.2 ± 1.2 nm wide and 21.2 ± 1.9 nm long)

Performance Verification:

  • Under optimal conditions, chromatophores should achieve ATP production rates of ~80-90 ATP molecules per second per ATP synthase

  • Test ATP production in response to light to confirm photophosphorylation activity

What approaches can be used to study the functional roles of individual b subunits in the ATP synthase complex?

To investigate the distinct contributions of individual b subunits, researchers can employ the following methodological approaches:

Genetic Complementation System:

  • Develop expression systems that allow the co-expression of two different b subunits (e.g., one wild-type and one mutant, or two different mutants)

  • Create specific mutations in conserved regions (e.g., b-Arg-36) or C-terminal domains known to affect function

  • Express heterodimeric b subunits in ATP synthase-deficient cells

  • Assess ATP synthase assembly and function through complementation analysis

Functional Assessment Methods:

  • ATP Synthesis/Hydrolysis Assays: Measure the ability of complemented systems to produce or hydrolyze ATP

  • Growth Phenotype Analysis: For bacterial systems, assess growth under conditions requiring oxidative phosphorylation

  • Complex Assembly Analysis: Use blue native PAGE or immunoprecipitation to determine if heterodimeric b subunits assemble into complete F1F0 complexes

This approach has demonstrated that heterodimeric ATP synthase complexes can be functional even when both b subunits individually contain inactivating mutations, indicating that each b subunit makes unique contributions to peripheral stalk function .

How can researchers assess ATP production efficiency in chromatophore-based systems?

When analyzing ATP production in chromatophore-based systems, several parameters should be considered:

Quantitative Parameters for Assessment:

ParameterTypical ValuesMeasurement Method
ATP production rate80-100 ATP·s⁻¹ per ATP synthaseLuciferase-based assays
ATP synthase density~1.6 ATP synthases per chromatophoreCryo-EM quantification
ATP concentration in artificial protocells~38 µMFreeze-thaw release and quantification
ATP synthase turnover number~80 s⁻¹Calculated from ATP production rate
Illumination conditionsContinuous actinic illuminationControlled light source

Analysis Approaches:

  • Time-course Analysis: Monitor ATP production over time to assess sustainability of the system

  • Light Dependence: Measure ATP production at different light intensities to determine optimal illumination conditions

  • Coupling Efficiency: Assess the relationship between proton gradient generation and ATP synthesis

  • Comparative Performance: Compare with other ATP-producing systems (chromatophores perform 10-18× better than other artificial organelles)

For artificial protocell applications, researchers should measure intraprotocell ATP concentration (typically ~38 µM) after light-driven synthesis, which can be done by releasing ATP through freeze-thaw cycles followed by quantification .

What are the key indicators of successful integration of chromatophores into artificial protocells?

Successful integration of chromatophores into artificial protocells (ASAPs - Artificial Simplified-Autotroph Protocells) can be verified through several key indicators:

Structural Indicators:

  • Proper encapsulation of chromatophores within giant unilamellar vesicles (GUVs)

  • Maintenance of vesicle integrity after chromatophore incorporation

  • Correct orientation of chromatophores with ATP synthase F1 domains accessible to internal vesicle components

Functional Indicators:

  • Light-Driven ATP Synthesis: Demonstration of increased ATP levels inside protocells upon illumination

  • Support of ATP-Dependent Processes: Ability to sustain ATP-consuming reactions such as DNA transcription

  • Coupling Efficiency: Effective conversion of light energy to chemical energy (ATP)

Experimental Verification Methods:

  • Confocal microscopy to visualize internal components and processes

  • RNA synthesis monitoring using fluorescent markers like acridine orange (AO)

  • Quantification of intraprotocell ATP through freeze-thaw release and measurement

A successful system should demonstrate the complete process chain: light capture → proton gradient formation → ATP synthesis → utilization of ATP for biochemical processes like RNA synthesis from DNA templates .

How do mutations in subunit b affect ATP synthase assembly and function?

Studies investigating mutations in subunit b have revealed important structure-function relationships:

Critical Regions for Function:

  • C-terminal Domain: The last four C-terminal amino acids are crucial for enzyme assembly

  • Conserved Arginine Residue: b-Arg-36 is evolutionarily conserved and essential for F1F0 ATP synthase function

  • Cysteine Residues: In Factor B (related to subunit b function), Cys-92 and Cys-94 are likely important for functional activity

Effects of Mutations:

Mutation TypeAssembly EffectFunctional EffectResearch Approach
C-terminal truncationsImpaired assemblyLoss of functionComplementation analysis
b-Arg-36 mutationsAssembled complexInactive enzymeSite-directed mutagenesis
Cysteine modificationsVariable assemblySensitivity to thiol reagentsChemical modification studies

Mutual Complementation Phenomenon:
An important finding is that when two different defective b subunits (each individually unable to support function) are expressed together, they can complement each other to form a functional ATP synthase complex . This indicates that:

  • The two b subunits contribute asymmetrically to ATP synthase function

  • Heterodimeric b subunits can assemble into functional F1F0 complexes

  • Each b subunit makes unique contributions to the peripheral stalk's functions

How can chromatophores be used to create energetically autonomous artificial cells?

Chromatophores offer a powerful platform for developing energetically self-sufficient artificial cells through the following methodological approach:

Design and Assembly Process:

  • Preparation of Giant Unilamellar Vesicles (GUVs) as the outer membrane compartment

  • Encapsulation of Chromatophores using highly efficient droplet transfer methods

  • Co-encapsulation of Reaction Components including:

    • ADP and inorganic phosphate (Pi) as ATP synthesis substrates

    • Enzymes and substrates for ATP-dependent processes (e.g., T7 RNA polymerase, DNA templates, nucleotides)

    • Any necessary cofactors or additional metabolic components

Functional Integration:
The fully assembled system should demonstrate:

  • Light-driven proton pumping across chromatophore membranes

  • ATP synthesis by chromatophore ATP synthases (~100 ATP·s⁻¹ per ATP synthase)

  • Utilization of ATP for metabolic processes like DNA transcription

Validation Methods:

  • Monitor RNA synthesis within individual vesicles using fluorescent dyes like acridine orange

  • Quantify ATP production through specialized assays

  • Track metabolic activity over time to assess sustainability

This approach has successfully produced Artificial Simplified-Autotroph Protocells (ASAPs) capable of using light energy to drive ATP-dependent DNA transcription, demonstrating a fundamental step toward creating autonomous artificial cells with photosynthetic capabilities .

What role does the peripheral stalk play in ATP synthase assembly and stability?

The peripheral stalk, which includes subunit b, plays several crucial roles in ATP synthase assembly and stability:

Structural Contributions:

  • Provides physical stabilization of the c-ring/F1 complex

  • Acts as a stator that prevents rotation of the F1 sector during catalysis

  • Forms a connection between the membrane-embedded F0 sector and the catalytic F1 domain

Assembly Process Involvement:
Current models based on research findings suggest that:

  • The peripheral stalk is important for the stability of the c-ring/F1 complex during assembly

  • Assembly of ATP synthase in yeast (and likely mammals) involves multiple modules: the c-ring, F1, and the Atp6p/Atp8p complex

  • Subunit A6L (ATP8) provides a physical link between the proton channel and other peripheral stalk subunits

Proposed Assembly Pathway:

  • Assembly of the c-ring

  • Binding of F1 to the c-ring

  • Association of the stator arm components (including subunit b)

  • Final addition of subunits a and A6L (ATP6 and ATP8)

This modular assembly approach involves two separate pathways (F1/c-ring and ATP6/ATP8/stator subunits) that converge at the final stage, allowing for coordinated expression between nuclear-encoded and mitochondrially-encoded components .

What are current challenges in engineering ATP synthase complexes with modified b subunits?

Engineering ATP synthase complexes with modified b subunits presents several challenges that researchers must address:

Major Challenges:

  • Structural Constraints:

    • Maintaining the correct dimeric structure of b subunits

    • Preserving critical interactions with both F1 and F0 sectors

    • Ensuring proper folding of engineered subunits

  • Functional Requirements:

    • Preserving stator function during catalytic rotary motion

    • Maintaining proper spacing between F1 and F0 domains

    • Supporting appropriate conformational flexibility

  • Assembly Integration:

    • Ensuring modified subunits incorporate correctly into the complex assembly pathway

    • Coordinating assembly with other ATP synthase components

    • Avoiding interference with critical protein-protein interactions

Promising Approaches:

  • Complementation Systems:

    • Utilize heterodimeric b subunit expression systems to study asymmetric functions

    • Exploit mutual complementation between different mutant b subunits

    • Engineer chimeric b subunits with domains from different species

  • Cryo-EM Guided Design:

    • Use high-resolution structural data to guide rational design of modifications

    • Focus modifications on non-conserved regions to minimize functional disruption

    • Apply molecular dynamics simulations to predict effects of modifications

  • Modular Assembly Approaches:

    • Leverage natural assembly pathways that involve distinct modules

    • Engineer modified b subunits that can participate in normal assembly sequences

    • Develop in vitro assembly systems to test modified components

These approaches can potentially lead to engineered ATP synthase complexes with novel properties for biotechnological applications while advancing our understanding of structure-function relationships in this remarkable molecular machine.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.