Recombinant Atractaspis micropholis Cytochrome b (MT-CYB)

Shipped with Ice Packs
In Stock

Description

Background of Atractaspis micropholis

Atractaspis micropholis, commonly known as the Mole viper, is a venomous snake species found primarily in Sudan savanna areas of Africa . This fossorial (burrowing) snake belongs to the family Atractaspididae and is characterized by its slender body, small eyes, and specialized fangs adapted for subterranean hunting. The species has been documented in ecological studies focusing on reptile diversity, particularly in African savanna ecosystems. Understanding the molecular components of its respiratory system, including mitochondrial proteins such as Cytochrome B, provides valuable insights into both evolutionary relationships and physiological adaptations of this species.

Overview of Cytochrome B (MT-CYB)

Cytochrome B (MT-CYB) functions as a critical component of the mitochondrial respiratory chain, specifically operating within the ubiquinol-cytochrome c reductase complex (Complex III or cytochrome b-c1 complex) . This integral membrane protein plays an essential role in cellular energy production by mediating electron transfer from ubiquinol to cytochrome c. The process contributes significantly to the generation of a proton gradient across the mitochondrial membrane, which ultimately drives ATP synthesis through oxidative phosphorylation . MT-CYB is encoded in the mitochondrial genome, and its sequence is frequently utilized in phylogenetic studies due to its relatively conserved evolutionary rate compared to other mitochondrial genes, making it valuable for establishing evolutionary relationships between species.

Significance of Recombinant Proteins in Research

Recombinant protein technology has revolutionized biochemical and molecular research by enabling the production of pure, isolated proteins for detailed study. For proteins like Cytochrome B that are naturally embedded in membrane complexes, recombinant expression provides a means to obtain sufficient quantities for structural analysis, functional studies, and antibody production. The availability of recombinant Atractaspis micropholis Cytochrome B allows researchers to investigate the specific properties of this mitochondrial protein without the complications of extracting it from native tissue sources. Additionally, the incorporation of affinity tags, such as the His-tag in this recombinant protein, facilitates purification processes and potential interaction studies with other components of the respiratory chain.

Gene Information

The gene encoding this protein is designated as MT-CYB, with several recognized synonyms including COB, CYTB, MTCYB, Complex III subunit 3, Cytochrome b-c1 complex subunit 3, and Ubiquinol-cytochrome-c reductase complex cytochrome b subunit . The protein has been assigned the UniProt identifier P87421, which provides a standardized reference point for accessing additional information about this specific protein in biological databases . As a mitochondrial gene, MT-CYB is inherited maternally and exhibits specific evolutionary patterns that make it valuable for phylogenetic studies, particularly in determining evolutionary relationships among snake species and other reptiles.

Functional Domains

Cytochrome B proteins typically contain multiple transmembrane domains that anchor the protein within the mitochondrial inner membrane. These hydrophobic segments form alpha-helices that span the membrane, with hydrophilic loops connecting them on both sides of the membrane. The protein contains binding sites for two heme groups (heme bH and heme bL), which are essential for its electron transport function. Additionally, the protein includes quinone binding sites that facilitate the interaction with ubiquinol and the transfer of electrons through the respiratory chain. The specific domain structure of Atractaspis micropholis Cytochrome B likely follows the conserved domain organization characteristic of cytochrome b proteins across species, though species-specific variations may exist that reflect evolutionary adaptations to particular ecological niches.

coli Expression System

The recombinant Atractaspis micropholis Cytochrome B protein is produced using an E. coli expression system , which represents one of the most common and efficient platforms for recombinant protein production. E. coli provides several advantages for protein expression, including rapid growth, high protein yields, and well-established genetic manipulation techniques. For the production of this specific protein, the coding sequence for Atractaspis micropholis Cytochrome B was likely cloned into an expression vector and transformed into an E. coli strain optimized for protein production. The bacterial cells then synthesize the foreign protein upon induction, after which the protein can be extracted and purified through a series of chromatographic steps.

Fusion Tags and Their Significance

The recombinant protein is fused with an N-terminal Histidine (His) tag , which consists of multiple histidine residues (typically six) added to the N-terminus of the protein sequence. This affinity tag serves several critical purposes in the production and utilization of the recombinant protein:

  1. Simplified purification through immobilized metal affinity chromatography (IMAC)

  2. Enhanced solubility of the expressed protein

  3. Facilitated detection using anti-His antibodies

  4. Potential for controlled immobilization in experimental setups

The His-tag does not typically interfere with the protein's structure or function, making it an excellent choice for recombinant protein production when structural integrity is essential for downstream applications. For membrane proteins like Cytochrome B, the tag may also assist in solubilization and handling during the purification process.

Purification Techniques

While specific purification methods are not explicitly detailed in the available information, the presence of the His-tag suggests that the recombinant Atractaspis micropholis Cytochrome B is likely purified using immobilized metal affinity chromatography (IMAC). In this technique, the histidine residues in the tag bind to immobilized metal ions (often Ni²⁺ or Co²⁺) on a chromatography column, allowing the tagged protein to be selectively retained while other cellular proteins are washed away. The bound protein can then be eluted using either a competing molecule like imidazole or by altering the pH of the buffer. The high purity level of greater than 90%, as determined by SDS-PAGE , indicates an effective purification process that yields a product suitable for research applications requiring high-purity materials.

Physical and Chemical Characteristics

The recombinant Atractaspis micropholis Cytochrome B is supplied as a lyophilized powder , which enhances its stability during shipping and storage. While the molecular weight is not explicitly stated in the available information, it can be estimated based on the 214 amino acid sequence plus the His-tag. Typical Cytochrome B proteins have molecular weights of approximately 42-45 kDa, with some variation depending on the specific species and the presence of any fusion tags. The protein's hydrophobic nature, derived from its multiple transmembrane domains, presents challenges for handling in aqueous solutions and may require the addition of detergents or other solubilizing agents for optimal solubility when reconstituted from the lyophilized form.

Reconstitution Protocols

For reconstitution of the lyophilized protein, several specific recommendations are provided in the product information:

  1. Brief centrifugation of the vial prior to opening to bring contents to the bottom

  2. Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  3. Addition of 5-50% glycerol (final concentration) for long-term storage, with a default recommendation of 50% glycerol

  4. Aliquoting for storage at -20°C to -80°C

The reconstituted protein is maintained in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 . Trehalose in the storage buffer serves as a cryoprotectant and stabilizing agent, helping to preserve the protein's native conformation during freezing and thawing processes. The careful attention to buffer composition and storage conditions reflects the challenges associated with maintaining the stability of membrane proteins in vitro.

Mitochondrial Respiratory Chain Function

Cytochrome B is a central component of Complex III (ubiquinol-cytochrome c reductase complex) in the mitochondrial respiratory chain . This complex plays a crucial role in the process of oxidative phosphorylation, which generates the majority of cellular ATP in aerobic organisms. As part of the electron transport chain, Complex III accepts electrons from ubiquinol (the reduced form of Coenzyme Q) and transfers them to cytochrome c, contributing to the proton gradient that drives ATP synthesis. The b-c1 complex mediates electron transfer from ubiquinol to cytochrome c, forming an essential link in the respiratory chain . While the specific functional characteristics of Atractaspis micropholis Cytochrome B are not detailed in the available information, its fundamental role is likely conserved across species due to the essential nature of mitochondrial energy production.

Electron Transfer Mechanisms

The mechanism of electron transfer in Cytochrome B involves the coordination of heme groups within the protein structure. These heme prosthetic groups, consisting of iron atoms held within porphyrin rings, facilitate the sequential transfer of electrons through the protein. The process, known as the Q-cycle, involves:

  1. Oxidation of ubiquinol (QH₂) at the Qo site, releasing two electrons

  2. Transfer of one electron to the iron-sulfur protein (ISP) and then to cytochrome c

  3. Transfer of the second electron through heme bL and heme bH to reduce ubiquinone at the Qi site

This elaborate mechanism couples electron transfer to proton translocation across the inner mitochondrial membrane, contributing to the electrochemical gradient that powers ATP synthesis. The specific amino acid residues in the Atractaspis micropholis Cytochrome B sequence likely play critical roles in coordinating the heme groups and facilitating these electron transfer steps.

Current Research Utilization

The recombinant Atractaspis micropholis Cytochrome B protein is primarily indicated for use in SDS-PAGE applications , suggesting its utility in protein characterization studies, antibody validation, and potentially as a standard in comparative protein analyses. The high purity of the recombinant protein (>90%) makes it suitable for these analytical applications where contaminants could interfere with results. The protein may also serve as an antigen for the production of specific antibodies against snake Cytochrome B, which could be valuable tools for immunological studies or the development of detection methods. Current applications focus on basic biochemical characterization and analytical techniques, providing foundational data for more specialized studies.

Potential Applications in Molecular Biology

Beyond the specified applications, recombinant Cytochrome B from Atractaspis micropholis could potentially be utilized in:

  1. Structural studies to elucidate the three-dimensional conformation of snake mitochondrial proteins

  2. Comparative biochemical analyses to understand evolutionary adaptations in mitochondrial function across reptile species

  3. Protein-protein interaction studies to identify species-specific variations in respiratory complex assembly

  4. Development of functional assays for electron transport activity

  5. Phylogenetic studies to clarify evolutionary relationships among snake species

These applications could provide insights into both the basic biology of snake metabolism and potentially inform broader questions about mitochondrial function and evolution. The availability of purified recombinant protein enables investigations that would be difficult or impossible with native tissue samples alone.

Limitations and Considerations

When working with recombinant Atractaspis micropholis Cytochrome B, several limitations should be considered:

  1. The protein is explicitly labeled "Not For Human Consumption" , indicating its restriction to research purposes only

  2. As a membrane protein, Cytochrome B may have limited solubility in aqueous solutions without appropriate detergents

  3. The presence of the His-tag, while beneficial for purification, could potentially affect certain aspects of protein function or interaction studies

  4. The E. coli expression system may not reproduce all post-translational modifications that might be present in the native protein

Researchers should evaluate these considerations in the context of their specific experimental objectives when deciding whether this recombinant protein is suitable for their needs. Additionally, the reconstitution and handling procedures should be carefully followed to maintain protein integrity and functionality.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type requirement, please inform us. We will prioritize fulfilling your request if possible.
Synonyms
MT-CYB; COB; CYTB; MTCYB; Cytochrome b; Complex III subunit 3; Complex III subunit III; Cytochrome b-c1 complex subunit 3; Ubiquinol-cytochrome-c reductase complex cytochrome b subunit; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-214
Protein Length
full length protein
Species
Atractaspis micropholis (Mole viper)
Target Names
Target Protein Sequence
SINYXNMSNHHMLSTFNLLPVGSNISTWWNFGSMLMTCLALQTITGFFLAIHYTANINLA FSSIMHITRDIPYGWIMQNLHAIGASMFFVCIYIHIARGIYYGSYLNKEVWLSGVILLTA LMATAFFGYVLPWGQMSFWAATVITNLLTAIPYLGTMLTTWLWGGFSINDPTLTRFFALH FVLPFIIISMSSIHIILLHNEGSSNPLGTNSDID
Uniprot No.

Target Background

Function
Cytochrome b is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. The b-c1 complex facilitates electron transfer from ubiquinol to cytochrome c. This process contributes to the generation of a proton gradient across the mitochondrial membrane, which is subsequently used for ATP synthesis.
Protein Families
Cytochrome b family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is cytochrome b (MT-CYB) and why is it significant in Atractaspis micropholis research?

Cytochrome b (MT-CYB) is a protein component of the mitochondrial respiratory chain complex III (also known as the cytochrome bc1 complex). In Atractaspis species, MT-CYB is encoded by mitochondrial DNA (mtDNA) and consists predominantly of hydrophobic protein with multiple transmembrane helices. The significance of studying MT-CYB in Atractaspis micropholis lies in understanding the energy metabolism of these venomous snakes and potential evolutionary adaptations related to their unique ecology and venom production .

MT-CYB contains binding sites for ubiquinol (Q sites) and contributes to the generation of the proton gradient essential for ATP synthesis. Beyond its metabolic function, research on snake MT-CYB provides insights into evolutionary relationships and adaptations among venomous reptiles .

What expression systems are most suitable for producing recombinant Atractaspis MT-CYB?

Based on experimental approaches with other cytochrome b proteins, yeast expression systems have proven particularly effective for recombinant production of functional MT-CYB. Saccharomyces cerevisiae offers advantages due to its eukaryotic cellular machinery, which provides appropriate post-translational modifications and membrane insertion capabilities .

For Atractaspis MT-CYB, the methodology employed for human MT-CYB can be adapted, including:

  • Cloning the intron-less sequence of the mt-cyb gene into an appropriate vector (such as pCRscript)

  • Site-directed mutagenesis when specific variants need to be studied

  • Transformation of yeast via methods such as microprojectile bombardment

  • Verification of homoplasmy (containing only one mtDNA population)

How does MT-CYB from Atractaspis compare structurally to human and other snake MT-CYB proteins?

While specific structural information on Atractaspis micropholis MT-CYB is limited in the literature, comparative analysis with human MT-CYB suggests shared fundamental features. Both contain:

  • Multiple transmembrane helices (typically eight)

  • Binding sites for ubiquinol and inhibitors (Qo and Qi sites)

  • Heme groups essential for electron transport

Evolutionary analysis of reptile proteins, including those from venomous species like Atractaspis, often reveals conservation of catalytic domains while allowing for species-specific adaptations in non-catalytic regions. These adaptations may relate to environmental pressures, metabolic requirements, or other selective forces unique to burrowing asps .

What experimental approaches can resolve discrepancies in MT-CYB functional data between in vitro and in vivo systems?

Researchers encountering discrepancies between recombinant MT-CYB behavior in vitro versus in vivo should consider a multi-faceted approach:

  • Membrane environment reconstitution: Incorporate recombinant MT-CYB into liposomes with lipid compositions mimicking native Atractaspis mitochondrial membranes.

  • Complementary assays: Employ both cytochrome c reduction activity measurements and respiratory growth assays to comprehensively evaluate function.

  • Inhibitor titration studies: Use multiple inhibitors and determine IC50 values normalized by complex III concentration to assess functional characteristics .

  • Temperature-dependent activity profiles: Given that snake physiology operates across varied temperature ranges, testing recombinant MT-CYB activity at different temperatures (15-40°C) may reveal functional properties masked at standard laboratory conditions.

The table below illustrates a methodological approach to characterizing MT-CYB variants based on techniques described for human variants:

ParameterPrimary AssaySecondary ValidationData Interpretation
Catalytic ActivityCytochrome c reductionOxygen consumptionComparison to wild-type activity
Inhibitor SensitivityIC50 determinationGrowth inhibitionNormalized by complex III concentration
StabilityThermal denaturationProtease resistanceHalf-life determination
ROS ProductionH2O2 measurementSuperoxide detectionCorrelation with structural features

How do single amino acid substitutions in MT-CYB catalytic domains affect venom toxicity and metabolism in Atractaspis species?

Single amino acid substitutions in MT-CYB catalytic domains can have profound effects on protein function, potentially influencing both snake metabolism and indirectly affecting venom production. Drawing parallels from human MT-CYB research, substitutions near binding sites (Qo and Qi) may:

  • Alter enzyme efficiency and energy production

  • Modify reactive oxygen species (ROS) generation

  • Change sensitivity to inhibitory compounds

For example, in human MT-CYB, the m.15257G>A mutation (p.Asp171Asn) increases sensitivity to atovaquone, while m.14798T>C (p.Phe18Leu) enhances sensitivity to clomipramine . Similar mutations in Atractaspis MT-CYB might alter metabolic efficiency with consequences for energy-intensive processes like venom production.

To study these effects, researchers should consider:

  • Creating recombinant variants with site-directed mutagenesis

  • Testing each variant for catalytic efficiency, ROS production, and inhibitor sensitivity

  • Correlating findings with structural models and evolutionary conservation analysis

What are the most effective approaches for analyzing the evolutionary significance of MT-CYB variations among Atractaspis species and other venomous reptiles?

Analyzing the evolutionary significance of MT-CYB variations requires an integrated approach combining:

  • Comprehensive phylogenetic analysis: Construct robust phylogenetic trees using MT-CYB sequences from multiple Atractaspis species and other venomous reptiles. This helps identify lineage-specific adaptations versus conserved features under purifying selection.

  • Selection pressure analysis: Calculate dN/dS ratios (non-synonymous to synonymous substitution rates) to identify regions under positive, neutral, or purifying selection.

  • Structural mapping: Map variable regions onto 3D structural models to determine if variations cluster in functional domains or surface-exposed regions.

  • Functional validation: Express recombinant variants and assess biochemical differences to connect genetic variation with functional consequences.

  • Ecological correlation: Analyze whether MT-CYB variations correlate with ecological niches, predatory behavior, or specific adaptations of different Atractaspis species .

The evolutionary study of Atractaspis cytochrome b should consider the taxonomic complexity of this genus, including synonymous classifications (like A. microlepidota and A. micropholis) and subspecies relationships to ensure accurate comparative analyses .

What expression and purification protocol optimizations are critical for high-yield recombinant Atractaspis MT-CYB production?

Optimizing expression and purification of recombinant Atractaspis MT-CYB requires addressing several key challenges:

  • Codon optimization: Adapting the Atractaspis MT-CYB gene sequence to the codon usage bias of the expression system (e.g., yeast) can significantly improve expression levels.

  • Vector selection: For membrane proteins like MT-CYB, vectors with appropriate promoters and fusion tags are critical. Consider inducible promoters to minimize toxicity during growth phases.

  • Expression conditions optimization:

    • Temperature: Often lower temperatures (16-25°C) improve folding

    • Induction timing: Inducing at optimal cell density

    • Media composition: Supplementation with heme precursors may improve incorporation

    • Aeration: Proper oxygenation is crucial for respiratory chain components

  • Solubilization and purification strategy:

    • Detergent screening: Test multiple detergents (DDM, LMNG, digitonin) for optimal solubilization

    • Purification method: Affinity chromatography followed by size exclusion chromatography

    • Buffer optimization: Include stabilizers and appropriate pH conditions

Following the methodology employed for human MT-CYB variants, researchers should verify functional expression through enzymatic activity assays rather than relying solely on protein yield metrics .

How can researchers accurately assess the catalytic properties of recombinant Atractaspis MT-CYB in complex III?

Accurately assessing the catalytic properties of recombinant Atractaspis MT-CYB within complex III requires multiple complementary approaches:

A comprehensive analysis should include data tables comparing wild-type and variant MT-CYB across these parameters, controlling for protein expression levels and complex assembly efficiency.

What analytical techniques are best suited for studying potential interactions between Atractaspis MT-CYB and venom components?

Investigating potential interactions between MT-CYB and venom components requires sophisticated analytical approaches:

  • Co-immunoprecipitation (Co-IP): Using antibodies against MT-CYB or specific venom components to pull down potential protein complexes.

  • Surface Plasmon Resonance (SPR): Measuring real-time binding kinetics between immobilized MT-CYB and flowing venom fractions to identify specific interactions.

  • Isothermal Titration Calorimetry (ITC): Determining thermodynamic parameters of binding interactions between purified MT-CYB and candidate venom components.

  • Proximity Labeling: Using techniques like BioID or APEX to identify proximal proteins in vivo when MT-CYB is expressed in native contexts.

  • Proteomic Analysis: Mass spectrometry-based approaches to identify proteins that co-purify with MT-CYB under native conditions.

These techniques should be complemented by functional assays to determine whether any identified interactions have biological significance. Since Atractaspis venom contains diverse toxins, including sarafotoxins, fasciculins, and other components described in toxinology literature, systematic screening may reveal unexpected interactions between metabolic proteins and venom components .

How might CRISPR-based approaches enhance our understanding of MT-CYB function in Atractaspis species?

CRISPR-Cas9 technology offers powerful approaches for studying MT-CYB in Atractaspis species, particularly through:

  • Heterologous expression systems: Using CRISPR to replace endogenous cytochrome b in model organisms (yeast, cell lines) with Atractaspis MT-CYB to study its function in well-characterized backgrounds.

  • Domain swapping experiments: Creating chimeric proteins with domains from different species to identify regions responsible for specific functional properties.

  • Mitochondrial DNA editing: Although technically challenging, recent advances in mitochondrial CRISPR approaches could potentially allow direct editing of MT-CYB in cell culture models.

  • Transcriptional regulation studies: Using CRISPR interference or activation to study factors regulating MT-CYB expression, which might reveal connections to venom production pathways.

These approaches could help establish causal relationships between MT-CYB variations and functional outcomes, moving beyond correlative studies that dominate current literature on snake mitochondrial genomics .

What are the comparative aspects of MT-CYB across venomous snake lineages that might inform evolutionary toxinology?

Comparative analysis of MT-CYB across venomous snake lineages offers insights into both basic metabolism and potential co-evolutionary relationships with venom systems:

  • Convergent evolution analysis: Identifying parallel changes in MT-CYB across independent venomous lineages may reveal adaptations supporting venom production.

  • Metabolic adaptation mapping: Correlating MT-CYB variations with ecological niches, hunting strategies, and venom potency across species.

  • Molecular clock applications: Using MT-CYB sequence divergence rates to estimate divergence times of venom systems and components.

  • Structure-function comparison: Mapping sequence differences onto structural models to identify lineage-specific adaptations in catalytic or regulatory domains.

This comparative approach should examine MT-CYB from diverse venomous snake families, including Atractaspididae, Elapidae, and Viperidae, contextualizing Atractaspis micropholis within the broader evolutionary landscape of venomous reptiles .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.