Recombinant Atractosteus spatula Cytochrome c oxidase subunit 1 (mt-co1)

Shipped with Ice Packs
In Stock

Description

Molecular Overview

MT-CO1 is encoded by the mitochondrial genome and is indispensable for oxygen reduction in oxidative phosphorylation. In Atractosteus spatula (alligator gar), this subunit forms part of a highly conserved heme-copper oxidase family, featuring a bimetallic center (heme a3 and copper B) essential for proton pumping and electron transfer . The recombinant variant retains these functional domains while enabling scalable production for research.

Production and Purification

Recombinant MT-CO1 is synthesized using E. coli expression systems, followed by affinity chromatography (via N-terminal His-tag) and lyophilization .

Role in Electron Transport:

  • Catalyzes the transfer of electrons from cytochrome c to oxygen, coupled with proton translocation across mitochondrial membranes .

  • Structural studies highlight conserved histidine residues coordinating heme and copper centers .

Species-Specific Variations:

Comparative genomic analyses of Atractosteus spatula and related species (e.g., Polypterus sp., Lepisosteus oculatus) reveal evolutionary conservation in MT-CO1 sequences, supporting its utility in phylogenetic studies .

Environmental DNA (eDNA) Detection:

  • MT-CO1’s COI region is a biomarker for detecting alligator gar in aquatic ecosystems. Quantitative PCR (qPCR) assays using COI primers show significant correlation (R² = 0.3356, p < 0.05) between eDNA copy numbers and fish biomass .

  • Advantage Over 12S rRNA: Higher specificity and sensitivity for invasive species monitoring .

Research Challenges and Innovations

  • Stability Issues: Repeated freeze-thaw cycles degrade activity; glycerol (50%) is recommended for long-term storage .

  • Genomic Resources: A chromosome-level genome assembly of Atractosteus spatula (contig N50 = 15.7 Mb) has enhanced gene annotation accuracy, aiding recombinant protein optimization .

Future Directions

  • CRISPR/Cas9 Editing: Modifying MT-CO1 in model organisms to study mitochondrial diseases.

  • Bioremediation: Engineering MT-CO1 variants to tolerate hypoxic conditions in polluted ecosystems.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order. We will fulfill your request based on availability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
mt-co1; coi; coxi; mtco1; Cytochrome c oxidase subunit 1; Cytochrome c oxidase polypeptide I; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Atractosteus spatula (Alligator gar) (Lepisosteus spatula)
Target Names
Target Protein Sequence
HLFWFFGHPEVYILILPGFGMISHIVAYYAGKKEPFGYMGMVWAMMAIGLLGFIVWAHHM FTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGSIKWDTPLLWALGFIFLFTVGG LTGIVLANSSLDIMLHDTYYVVAHFHYVLSMGAVFAI
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 1 (mt-co1) is a crucial component of cytochrome c oxidase, the final enzyme in the mitochondrial electron transport chain responsible for driving oxidative phosphorylation. The respiratory chain comprises three multisubunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes collaborate to transfer electrons derived from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase is the component that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred through the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1. This active site is a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Protein Families
Heme-copper respiratory oxidase family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-CO1 and why is it significant in Atractosteus spatula research?

MT-CO1 (Cytochrome c Oxidase Subunit 1) is one of the core subunits of mitochondrial Cytochrome c oxidase (Cco), which plays a significant role in the physiological process of cellular respiration. In Atractosteus spatula (alligator gar), MT-CO1 is particularly interesting due to the species' evolutionary significance as a "living fossil" that has existed for approximately 100 million years . The study of MT-CO1 in this ancient species provides valuable insights into the evolution of mitochondrial function and can help researchers understand adaptations that have allowed this species to survive with minimal morphological changes for millions of years.

What are the general characteristics of Atractosteus spatula relevant to MT-CO1 studies?

Atractosteus spatula is a remarkable species with several unique physiological adaptations that make it interesting for MT-CO1 research:

  • Evolutionary persistence: Described as a "living fossil" that has existed for approximately 100 million years

  • Respiratory adaptations: Capable of breathing air and surviving above water for hours

  • Protective features: Possesses highly effective ganoid scales with specialized microstructural features

  • Habitat: Native to the Lower Mississippi River, relying on floodplain backwater areas for spawning

These characteristics suggest that Atractosteus spatula may have developed unique adaptations in its respiratory chain components, including MT-CO1, to survive in varying oxygen conditions and maintain metabolic efficiency across diverse environments.

How does the structure of MT-CO1 from Atractosteus spatula compare to that of other species?

While specific structural data for Atractosteus spatula MT-CO1 is limited in the provided search results, we can infer from related research that this protein likely shares key structural features with MT-CO1 proteins from other vertebrates. Based on studies of cytochrome c oxidase in other species, the protein likely contains:

  • Transmembrane helices that anchor it within the inner mitochondrial membrane

  • Metal-binding sites necessary for electron transport

  • Conserved amino acid residues critical for interaction with other subunits of the cytochrome c oxidase complex

For detailed structural comparisons, researchers would need to conduct multiple sequence alignment and phylogenetic analysis, similar to the approach used for COXII in Sitophilus zeamais, which demonstrated high sequence identity with COXII of other species .

What are the optimal conditions for recombinant expression of Atractosteus spatula MT-CO1?

Based on related research methodologies, a potential protocol for recombinant expression of Atractosteus spatula MT-CO1 would include:

  • Gene cloning: Isolation of the full-length cDNA of MT-CO1 gene from Atractosteus spatula tissue samples

  • Vector selection: Subcloning into an expression vector such as pET-32a, which has been successfully used for similar proteins

  • Expression system: Transformation into E. coli Transetta (DE3) or a similar expression system

  • Induction conditions: Optimization of IPTG concentration, temperature, and induction time

  • Protein purification: Affinity chromatography using Ni²⁺-NTA agarose for His-tagged recombinant protein

This approach is based on successful methodologies used for the expression of COXII from Sitophilus zeamais, where researchers achieved recombinant protein concentrations of approximately 50 μg/mL .

What techniques are most effective for analyzing the activity of recombinant MT-CO1?

For functional analysis of recombinant MT-CO1, researchers should consider the following techniques:

  • UV-spectrophotometry: To measure the catalytic oxidation of substrate Cytochrome c (Cyt c)

  • Infrared spectrometry: To analyze structural components and functional groups

  • Enzyme kinetics assays: To determine Km and Vmax values

  • Oxygen consumption measurements: Using oxygen electrodes to measure respiratory activity

  • Molecular docking: For investigating interactions with inhibitors or substrates

These analytical methods allow researchers to confirm the functionality of the recombinant protein and investigate its catalytic properties under various experimental conditions.

How can researchers isolate high-quality mtDNA from Atractosteus spatula tissues for MT-CO1 cloning?

A methodological approach for isolating high-quality mtDNA from Atractosteus spatula tissues would include:

  • Tissue selection: Freshly collected tissues with high mitochondrial content (muscle, liver, or heart)

  • Homogenization: Gentle mechanical disruption in an isotonic buffer to preserve mitochondrial integrity

  • Differential centrifugation: Sequential centrifugation steps to isolate the mitochondrial fraction

  • DNA extraction: Using specialized mtDNA isolation kits or phenol-chloroform extraction methods

  • Quality assessment: Evaluation of DNA purity using spectrophotometry (A260/A280 ratio) and agarose gel electrophoresis

  • PCR verification: Amplification with MT-CO1-specific primers to confirm isolation success

For tissues with high lipid content or complex matrices, additional purification steps may be necessary to remove PCR inhibitors and ensure high-quality template DNA for subsequent cloning procedures.

How can expression patterns of MT-CO1 across different tissues in Atractosteus spatula inform evolutionary adaptations?

Analyzing MT-CO1 expression patterns across different tissues in Atractosteus spatula can provide insights into tissue-specific metabolic requirements and evolutionary adaptations:

  • Methodology: Quantitative PCR (qPCR) and Western blot analysis can be used to detect mRNA and protein expression levels across various tissues, similar to approaches used in other species

  • Comparative analysis: Expression levels in tissues with different oxygen requirements (e.g., heart, brain, muscle, liver) can reveal metabolic specializations

  • Age-dependent changes: Comparing MT-CO1 expression between juvenile and adult specimens can identify developmental regulation patterns

  • Environmental influence: Examining expression changes under various environmental conditions (hypoxia, temperature variation) can reveal adaptive responses

This multi-tissue, multi-condition analysis approach can illuminate how this ancient species has optimized its respiratory chain function across different tissues to support its unique physiological adaptations, such as air-breathing capability and extended survival out of water .

What are the challenges in analyzing the relationship between MT-CO1 structure and function in Atractosteus spatula?

Researchers face several methodological challenges when investigating structure-function relationships of MT-CO1 in Atractosteus spatula:

  • Protein complexity: MT-CO1 is a membrane protein with multiple transmembrane domains, making structural analysis technically challenging

  • Expression systems: Eukaryotic membrane proteins often require specialized expression systems beyond standard E. coli platforms

  • Post-translational modifications: Potential modifications may be critical for function but difficult to reproduce in recombinant systems

  • Functional assessment: The need for intact mitochondrial membranes or suitable membrane mimetics to assess native function

  • Evolutionary context: Interpreting structural features requires comparative analysis across multiple species

Addressing these challenges requires a multidisciplinary approach combining molecular biology, biochemistry, structural biology, and bioinformatics. Techniques such as site-directed mutagenesis followed by functional assays can help identify critical residues, while homology modeling based on related structures can provide preliminary structural insights.

How might oxidative stress affect MT-CO1 expression and function in Atractosteus spatula?

The relationship between oxidative stress and MT-CO1 function in Atractosteus spatula represents an important research area:

ParameterNormal ConditionsOxidative Stress ConditionsMethodological Approach
MT-CO1 mRNA expressionBaseline levelsPotentially altered (up or down)qPCR analysis
Protein levelsStable expressionMay show degradation or compensationWestern blot, ELISA
Enzymatic activityNormal electron transportPotentially reduced efficiencySpectrophotometric assays
Oxidative damageMinimalIncreased (measured by MDA levels)Thiobarbituric acid colorimetry
Correlation with antioxidant systemsBalanced interactionInverse relationship possibleCorrelation analysis

Based on studies in other species, like MRL/lpr mice, we might expect an inverse relationship between oxidative stress markers (such as malondialdehyde) and MT-CO1 expression levels, suggesting that MT-CO1 may be susceptible to ROS-induced oxidative damage . Given Atractosteus spatula's ability to survive in varying oxygen environments, investigating how this species might have evolved mechanisms to protect MT-CO1 from oxidative damage could yield valuable insights for both evolutionary biology and medical research.

How can phylogenetic analysis of MT-CO1 contribute to understanding Atractosteus spatula's evolutionary history?

MT-CO1 is widely used in phylogenetic studies due to its relatively slow evolutionary rate and conservation across species. For Atractosteus spatula research:

  • Sequence comparison methodology:

    • Multiple sequence alignment of MT-CO1 sequences from various fish species

    • Construction of phylogenetic trees using maximum likelihood or Bayesian methods

    • Molecular clock analysis to estimate divergence times

  • Key research questions addressable through MT-CO1 phylogenetics:

    • Verification of Atractosteus spatula's status as a "living fossil"

    • Estimation of divergence time from other gar species

    • Identification of selection pressures on the respiratory chain during evolution

    • Comparison with nuclear gene phylogenies to detect potential mitochondrial introgression

Similar approaches have been successfully employed for microsatellite analysis in Atractosteus spatula, revealing important population structure information . MT-CO1 analysis would complement these studies by providing insights at a different evolutionary scale.

What insights can comparative studies of MT-CO1 between Atractosteus spatula and other ancient fish species provide?

Comparative studies of MT-CO1 between Atractosteus spatula and other ancient fish lineages can reveal:

  • Convergent adaptations: Identification of similar adaptations in MT-CO1 that have evolved independently in different ancient lineages

  • Functional constraints: Highly conserved regions likely represent functionally critical domains

  • Unique adaptations: Amino acid substitutions specific to Atractosteus spatula may relate to its unique physiology

  • Correlation with respiratory strategies: Differences in MT-CO1 structure between air-breathing and exclusively water-breathing ancient fishes

These comparative analyses are particularly valuable given Atractosteus spatula's remarkable evolutionary persistence for approximately 100 million years with relatively little morphological change . The methodological approach would involve obtaining MT-CO1 sequences from multiple ancient fish species, conducting detailed sequence and structural comparisons, and correlating differences with physiological adaptations.

How does the recombinant expression of MT-CO1 compare to in vivo expression in Atractosteus spatula tissues?

Understanding the differences between recombinant and native MT-CO1 is crucial for accurate interpretation of experimental results:

CharacteristicRecombinant MT-CO1Native MT-CO1Analytical Method
Molecular weightMay include fusion tags (e.g., ~44 kDa with His-tag)Native size (~26 kDa)Western blot, mass spectrometry
Post-translational modificationsLimited in bacterial systemsComplete modificationsMass spectrometry, specific antibodies
Enzymatic activityOften reduced compared to nativeOptimal in native environmentSpectrophotometric assays
Protein-protein interactionsLacks interaction with other subunitsFunctions within complete complexCo-immunoprecipitation, blue native PAGE
Structural integrityMay have folding differencesNative conformationCircular dichroism, structural studies

To assess these differences, researchers should implement both in vitro studies with recombinant protein and ex vivo studies with tissue samples to compare enzyme kinetics, substrate specificity, and response to inhibitors. This dual approach provides a more complete understanding of MT-CO1 function while acknowledging the limitations of recombinant systems.

What are promising research applications of recombinant Atractosteus spatula MT-CO1?

Several promising research avenues for recombinant Atractosteus spatula MT-CO1 include:

  • Evolutionary biochemistry: Investigating how this ancient species' respiratory chain components have remained functional over millions of years

  • Bioenergetics: Examining potential adaptations in MT-CO1 that facilitate the species' ability to tolerate hypoxic conditions and breathe air

  • Structural biology: Resolving unique structural features that may provide insights into respiratory chain optimization

  • Comparative physiology: Using recombinant MT-CO1 to investigate differences in electron transport efficiency between ancient and modern fish species

  • Environmental adaptation: Studying how MT-CO1 function responds to temperature, pH, and oxygen availability

These research directions could yield valuable insights not only for evolutionary biology but also for biomimetic applications in developing more efficient energy conversion systems inspired by this ancient species' optimized mitochondrial components.

How might CRISPR-Cas9 technology be applied to study MT-CO1 function in Atractosteus spatula?

CRISPR-Cas9 technology offers powerful approaches to study MT-CO1 function in Atractosteus spatula:

  • Methodological considerations:

    • Development of cell culture systems from Atractosteus spatula tissues

    • Design of guide RNAs targeting specific regions of MT-CO1

    • Optimization of delivery methods for CRISPR-Cas9 components

    • Selection of appropriate knock-in reporters or markers

  • Research applications:

    • Creation of point mutations to identify functionally critical residues

    • Introduction of tagged versions for in vivo localization studies

    • Generation of tissue-specific knockdowns to assess tissue-dependent functions

    • Introduction of mutations found in other species to test evolutionary hypotheses

  • Challenges:

    • Limited genomic resources for Atractosteus spatula

    • Potential difficulties in establishing cell culture systems

    • Mitochondrial genome editing presents additional technical challenges

Despite these challenges, CRISPR-based approaches could provide unprecedented insights into MT-CO1 function in this evolutionarily significant species.

What research questions remain unanswered regarding MT-CO1's role in Atractosteus spatula's unique physiological adaptations?

Several critical research questions remain to be addressed:

  • Respiratory adaptation: How does MT-CO1 structure and function contribute to Atractosteus spatula's ability to breathe air and survive out of water for extended periods?

  • Longevity mechanisms: Does MT-CO1 in Atractosteus spatula exhibit specialized features that contribute to the species' evolutionary persistence?

  • Tissue-specific expression: How does MT-CO1 expression vary across tissues with different metabolic demands, similar to the tissue-specific variation observed in other species?

  • Oxidative stress resistance: Has Atractosteus spatula evolved specialized mechanisms to protect MT-CO1 from oxidative damage, potentially explaining its resilience?

  • Environmental response: How does MT-CO1 expression and function respond to environmental stressors such as temperature fluctuation, hypoxia, and pollutants?

Addressing these questions will require integrated approaches combining molecular biology, biochemistry, physiology, and ecological studies. The results could illuminate how this "living fossil" has optimized its respiratory chain to support its remarkable evolutionary persistence and unique physiological capabilities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.