Recombinant Atropa belladonna Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us; we will prioritize its implementation.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Atropa belladonna (Belladonna) (Deadly nightshade)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLANKPVEIEVPQAVLPDTVFEAVVRIPYDMQLKQV LANGKKGGLNVGAVLILPEGFELAPSDRISPEMKEKIGNLSFQSYRPNKKNILVIGPVPG KKYSEITFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAAGIVS KIIRKEKGGYEITITDASEGRQVVDIIPPGPELLVSEGESIKFDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFLASVILAQIFLVLKKKQFEKVQLAEMNF
Uniprot No.

Target Background

Function

Recombinant Atropa belladonna Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex facilitates electron transfer between photosystem II (PSII) and photosystem I (PSI), supports cyclic electron flow around PSI, and participates in state transitions.

Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f and why study it specifically from Atropa belladonna?

Apocytochrome f is the protein precursor that, upon heme attachment, forms cytochrome f—a key component of the cytochrome b6f complex central to photosynthetic electron transport. Studying this protein from Atropa belladonna is particularly valuable because this species belongs to the Solanaceae family with unique secondary metabolite production, including tropane alkaloids (atropine, hyoscyamine, and scopolamine) that may influence its photosynthetic apparatus. The methodological approach involves first isolating and sequencing the petA gene from chloroplast DNA using PCR amplification with degenerate primers based on conserved regions of cytochrome f. Researchers should employ comparative sequence analysis with other Solanaceae family members to identify unique regions that may correlate with the plant's specialized metabolism.

What expression systems are most suitable for recombinant Atropa belladonna Apocytochrome f production?

The selection of an appropriate expression system requires careful consideration of protein properties. Bacterial systems (E. coli BL21(DE3) or C41/C43 strains) offer high yield but may struggle with membrane protein folding. Plant-based expression systems like tobacco or Arabidopsis provide more native-like post-translational processing. For methodological implementation, researchers should:

Expression SystemAdvantagesDisadvantagesOptimization Strategies
E. coliHigh yield, established protocolsLack of plant-specific post-translational modificationsUse low-temperature induction (16-18°C), fusion tags (MBP, SUMO)
Yeast (P. pastoris)Eukaryotic processing, high density cultivationLonger production timeCodon optimization, inducible promoters
Plant systems (N. benthamiana)Native-like processingLower yield, longer production cycleTransient expression using viral vectors
Cell-free systemsRapid, controls for toxic proteinsExpensive, limited scaleSupplement with membrane mimetics

Researchers should conduct small-scale expression trials comparing these systems, evaluating protein yield, proper folding, and functional activity before scaling up.

How does the structural characterization of recombinant Apocytochrome f differ from native protein?

Structural characterization requires multiple complementary techniques. Methodologically, researchers should:

  • Begin with circular dichroism (CD) spectroscopy to compare secondary structure elements between recombinant and native proteins

  • Employ differential scanning calorimetry to analyze thermal stability differences

  • Use limited proteolysis followed by mass spectrometry to identify exposed regions

  • Perform native PAGE and size exclusion chromatography to assess oligomeric state

Comparison parameters should include:

  • Alpha-helical content (expected to be approximately 40-45% for properly folded cytochrome f)

  • Thermal transition temperatures (Tm values)

  • Accessibility of key functional residues

  • Heme coordination geometry (UV-visible spectroscopy)

Any significant differences between recombinant and native forms should be addressed through expression system modifications or protein engineering.

What are the key considerations when designing primers for cloning the petA gene from Atropa belladonna?

Primer design for the petA gene requires specific methodological considerations:

  • Analyze available Solanaceae petA sequences to identify conserved regions

  • Design primers with the following specifications:

    • 20-30 nucleotides length

    • 40-60% GC content

    • Tm between 55-65°C with <5°C difference between pairs

    • Add restriction sites with 3-6 nucleotide overhangs

  • For expression vector compatibility, incorporate:

    • A Kozak consensus sequence for eukaryotic expression

    • Appropriate tags (His6, FLAG, etc.) for purification

    • Signal peptides for proper localization if needed

Researchers should validate primers by checking for self-complementarity, potential secondary structures, and non-specific binding sites using tools like OligoAnalyzer or BLAST.

What experimental strategies can determine the redox potential of recombinant Atropa belladonna Apocytochrome f?

Determining the redox potential requires precise methodological approaches:

  • Spectroelectrochemical titration: Monitor absorbance changes at the α-band (~550 nm) during controlled potential application

  • Employ redox mediators covering the expected range (-100 to +400 mV vs. SHE)

  • Use the Nernst equation to fit the data:

E=E0+RTnFln[Ox][Red]E = E^0 + \frac{RT}{nF} \ln\frac{[Ox]}{[Red]}

Where:

  • E = applied potential

  • E^0 = midpoint potential

  • R = gas constant

  • T = temperature in Kelvin

  • n = number of electrons transferred

  • F = Faraday constant

  • [Ox]/[Red] = ratio of oxidized to reduced species

Comparative analysis should be performed at multiple pH values (5.5-8.0) to determine pH dependence, which is particularly relevant for understanding function within the variable pH environment of the thylakoid lumen during photosynthesis. Researchers should ensure protein stability throughout the experiment using activity assays before and after redox measurements.

How can researchers evaluate the interaction between recombinant Apocytochrome f and plastocyanin from Atropa belladonna?

This protein-protein interaction study requires multiple complementary approaches:

  • Surface plasmon resonance (SPR):

    • Immobilize recombinant Apocytochrome f on a CM5 sensor chip

    • Flow plastocyanin at varying concentrations (1 nM to 10 μM)

    • Determine association (ka) and dissociation (kd) rate constants

    • Calculate equilibrium dissociation constant (KD = kd/ka)

  • Isothermal titration calorimetry (ITC):

    • Measure heat changes during stepwise addition of plastocyanin to Apocytochrome f

    • Determine binding stoichiometry, enthalpy (ΔH), and entropy (ΔS) changes

  • Functional electron transfer kinetics:

    • Flash photolysis with absorption spectroscopy

    • Measure electron transfer rates under various ionic strength conditions

    • Compare with cross-species plastocyanin interactions

Researchers should conduct these experiments at physiologically relevant pH (6.0-7.5) and ionic strengths (50-200 mM), as these parameters significantly influence electron transfer protein interactions.

What approaches best resolve contradictory findings in electron transfer rates between native and recombinant Apocytochrome f?

When faced with contradictory kinetic data, researchers should implement this methodological troubleshooting sequence:

  • Verify protein integrity:

    • Compare spectroscopic properties (UV-visible absorption ratios)

    • Assess heme incorporation and coordination using magnetic circular dichroism

    • Confirm protein stability during measurement period

  • Standardize experimental conditions:

    • Use identical buffer composition, pH, and temperature

    • Prepare proteins using matched protocols for reduction/oxidation

    • Normalize protein concentrations accurately

  • Apply multiple measurement techniques:

    • Compare stopped-flow spectroscopy with laser flash photolysis

    • Use both steady-state and pre-steady-state kinetics

    • Measure under varying ionic strengths (50-300 mM)

  • Consider physiological context:

    • Reconstitute proteins in native-like membrane environments

    • Use proteoliposomes with defined lipid composition

    • Evaluate effects of membrane potential

Document all variables systematically in a comprehensive table comparing native vs. recombinant protein kinetic parameters under matched conditions.

How can site-directed mutagenesis be used to probe electron transfer pathways in Atropa belladonna Apocytochrome f?

Site-directed mutagenesis offers powerful insights into structure-function relationships. The methodological workflow should include:

  • Target selection:

    • Conserved residues near the heme group

    • Surface-exposed residues at potential plastocyanin docking sites

    • Proposed electron transfer pathway residues

  • Mutation design strategy:

    • Conservative substitutions (e.g., Phe→Tyr) to probe subtle effects

    • Charge inversions (e.g., Asp→Lys) to test electrostatic interactions

    • Size alterations (e.g., Val→Phe) to probe steric requirements

  • Analytical matrix for each mutant:

    • Structural integrity (CD spectroscopy, thermal stability)

    • Heme environment (UV-visible and resonance Raman spectroscopy)

    • Redox potential determination

    • Electron transfer kinetics with physiological partners

All mutants should be evaluated under identical conditions and compared to wild-type protein. A methodical approach is to create a series of mutants along proposed electron transfer pathways and measure distance-dependent electron transfer rates, which can be analyzed using the Marcus theory equation:

kET=k0exp(β(rr0))k_{ET} = k_0 \exp(-\beta(r-r_0))

Where:

  • k₀ = optimum electron transfer rate

  • β = decay factor

  • r = distance between electron donor and acceptor

  • r₀ = van der Waals contact distance

What purification strategies yield the highest purity and activity for recombinant Apocytochrome f?

A systematic purification strategy should include:

  • Initial extraction:

    • For membrane-associated protein, use mild detergents (DDM, LMNG)

    • Optimize detergent:protein ratio using activity assays

    • Include protease inhibitors and reducing agents

  • Multi-step chromatography:

    • Immobilized metal affinity chromatography (IMAC) if His-tagged

    • Ion exchange chromatography at pH where protein carries net charge

    • Size exclusion chromatography for final polishing

  • Quality assessment criteria:

    • SDS-PAGE (>95% purity)

    • Spectroscopic A280/A420 ratio (heme incorporation)

    • Mass spectrometry for intact mass verification

    • Electron transfer activity assay

Purification StepBuffer CompositionExpected Yield (%)Purity Increase
Crude extraction50 mM Tris-HCl pH 8.0, 150 mM NaCl, 0.03% DDM100-
IMACAbove + 10-250 mM imidazole gradient60-7070-80%
Ion exchange20 mM phosphate pH 7.0, 50-500 mM NaCl40-5085-90%
Size exclusion20 mM HEPES pH 7.5, 100 mM NaCl, 0.01% DDM30-40>95%

The final preparation should be flash-frozen in small aliquots with 10% glycerol and stored at -80°C for maximum stability.

How can proper folding and heme incorporation be verified in recombinant Apocytochrome f?

Proper folding verification requires multiple analytical techniques:

  • Spectroscopic analysis:

    • UV-visible spectroscopy (characteristic Soret band at ~420 nm and α/β bands at ~550-560 nm)

    • CD spectroscopy to confirm secondary structure elements

    • Fluorescence spectroscopy to assess tertiary structure

  • Heme incorporation analysis:

    • Pyridine hemochromogen assay to quantify heme content

    • Heme to protein ratio determination (ideally 1:1)

    • Redox activity via cyclic voltammetry

  • Functional assessment:

    • Electron transfer kinetics with natural electron donors/acceptors

    • pH dependence of activity (should match native protein)

    • Stability under various conditions (temperature, ionic strength)

Researchers should establish acceptance criteria for each parameter before large-scale production and consistently apply these standards across preparations.

What analytical techniques best characterize post-translational modifications in Atropa belladonna Apocytochrome f?

Post-translational modifications require sophisticated analytical workflow:

  • Sample preparation:

    • Enzymatic digestion with multiple proteases (trypsin, chymotrypsin)

    • Enrichment of modified peptides if necessary

    • Derivatization of specific modifications when applicable

  • Mass spectrometry analysis:

    • High-resolution LC-MS/MS with electron transfer dissociation

    • Multiple reaction monitoring for targeted modification sites

    • Top-down proteomics for intact protein analysis

  • Modification-specific strategies:

    • For phosphorylation: Titanium dioxide enrichment

    • For glycosylation: Lectin affinity and glycosidase treatments

    • For disulfide bonds: Differential alkylation with iodoacetamide

  • Data analysis workflow:

    • Database searching with variable modification parameters

    • Manual validation of key modification sites

    • Quantitative comparison with native protein

Results should be presented as a comprehensive map of all detected modifications with their site localization scores and relative stoichiometry.

What are common pitfalls in the expression and purification of recombinant Apocytochrome f and how can they be addressed?

Common challenges require systematic troubleshooting approaches:

ChallengePossible CausesTroubleshooting Strategy
Low expression yieldCodon bias, toxicity, protein degradationOptimize codon usage, use inducible systems, lower expression temperature, add protease inhibitors
Inclusion body formationRapid expression, improper foldingReduce induction temperature to 16-18°C, co-express chaperones, use solubility tags
Poor heme incorporationInsufficient heme availability, improper foldingSupplement growth medium with δ-aminolevulinic acid, ensure aerobic conditions
Aggregation during purificationDetergent concentration, hydrophobic interactionsScreen detergent types and concentrations, include glycerol or arginine
Loss of activityOxidation of critical residues, heme lossInclude reducing agents, avoid freeze-thaw cycles, optimize buffer conditions

For each challenge, implement a systematic approach:

  • Identify specific symptoms and potential causes

  • Design controlled experiments testing one variable at a time

  • Quantify improvement using objective measurements

  • Document optimized conditions for reproducibility

How can researchers design rigorous controls when studying inhibitor effects on recombinant Apocytochrome f?

Rigorous experimental design requires comprehensive controls:

  • Negative controls:

    • Denatured Apocytochrome f (heat-treated)

    • Apo-protein (heme removed)

    • Non-specific protein of similar size/structure

  • Positive controls:

    • Known inhibitors with established mechanisms

    • Concentration-dependent responses with standard compounds

    • Native protein for comparison

  • Specificity controls:

    • Structurally related compounds lacking inhibitory activity

    • Cross-species variants of Apocytochrome f

    • Mutants with altered binding sites

  • Methodological validation:

    • Multiple detection methods for inhibition

    • Reversibility tests (dialysis/dilution)

    • Time-dependent effects analysis

Results should be presented with complete statistical analysis, including replicate numbers, p-values, and confidence intervals. Dose-response curves should include Hill coefficients and IC50 values with appropriate error propagation.

What computational approaches can help predict structural differences between Atropa belladonna Apocytochrome f and well-characterized homologs?

Computational structural analysis requires a multi-tiered approach:

  • Sequence analysis:

    • Multiple sequence alignment of petA genes across species

    • Conservation scoring of functional residues

    • Identification of unique substitutions in Atropa belladonna

  • Homology modeling:

    • Template selection based on sequence identity and resolution

    • Model building with MODELLER, SWISS-MODEL, or Rosetta

    • Validation using PROCHECK, VERIFY3D, and ProSA

  • Molecular dynamics:

    • System preparation with appropriate membrane environment

    • Energy minimization and equilibration protocols

    • Production simulations (>100 ns) with AMBER or GROMACS

  • Analysis metrics:

    • RMSD and RMSF for structural stability assessment

    • Hydrogen bond network analysis

    • Essential dynamics using principal component analysis

    • Electrostatic surface potential comparison

Results should be validated experimentally where possible, using site-directed mutagenesis of predicted key residues followed by functional assays to confirm computational predictions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.