Recombinant Atropa belladonna ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Atropa belladonna ATP Synthase Subunit a, Chloroplastic (atpI)

Recombinant Atropa belladonna ATP synthase subunit a, chloroplastic (atpI) is a bioengineered protein produced via E. coli expression systems. This protein corresponds to the full-length ATP synthase subunit a (UniProt ID: P69371), a critical component of the chloroplast ATP synthase complex (CF₀CF₁), which generates ATP during photosynthesis by leveraging the proton electrochemical gradient .

The recombinant protein is His-tagged for purification and retains the native sequence of the chloroplastic ATP synthase subunit a, spanning 247 amino acids (MNVLSCSINTLKGLYDISGVEVGQHFYWQIGGFQVHGQVLITSWVVIAILLGSATIAVRNPQTIPTGGQNFFEYVLEFIRDVSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKIIQLPHGELAAPTNDINTTVALALLTSVAYFYAGLTKKGLGYFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMLLGLFTSGIQALIFATLAAAYIGESMEGHH) .

Gene and Protein Overview

AttributeDetail
Gene NameatpI
SynonymsATP synthase F₀ sector subunit a; F-ATPase subunit IV
Protein LengthFull-length (1–247 amino acids)
Subcellular LocalizationChloroplast F₀ sector (membrane-embedded)
FunctionProton translocation coupled to ATP synthesis via rotational catalysis

The atpI subunit forms part of the CF₀ subcomplex, which drives proton flux across the thylakoid membrane. This motion is mechanically linked to the CF₁ subcomplex, enabling ATP synthesis .

Recombinant Expression

The protein is expressed in E. coli using codon-optimized constructs to enhance solubility and yield. Key steps include:

  1. Cloning: Insertion of the atpI gene into expression vectors with His-tag fusion sequences.

  2. Fermentation: Cultivation in E. coli under conditions optimized for protein expression.

  3. Purification: Affinity chromatography (via His-tag) followed by ion-exchange or gel-filtration chromatography .

Quality Control

ParameterSpecification
Purity>90% (SDS-PAGE analysis)
Concentration0.1–1.0 mg/mL (post-reconstitution)
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
StabilityLyophilized powder; repeated freeze-thaw cycles discouraged

Biochemical Studies

The recombinant protein enables structural and functional analyses of the CF₀CF₁ complex:

  • Proton Translocation: Subunit a interacts with subunit c (atpH) to form proton-conducting channels. In spinach, this interaction was studied using recombinant subunit c, highlighting conserved mechanisms .

  • Redox Regulation: While subunit γ (CF₁) undergoes redox modulation in plants, subunit a’s role in proton gating remains under investigation .

Diagnostic and Detection Tools

Recombinant atpI is used in ELISA kits for quantitative detection in plant tissues, particularly in Solanaceae species like Atropa belladonna .

Plant Stress Responses

While not directly linked to atpI, ATP synthase subunits (e.g., α-subunit AtpA in tomato) modulate pathogen resistance and redox homeostasis, suggesting broader roles for ATP synthase components in stress adaptation .

References and Diverse Sources

  1. Product Specifications: Creative Biomart , CUSABIO , GeneBioSystems .

  2. Structural Insights: Cryo-EM studies of chloroplast ATP synthase , subunit c recombinant production .

  3. Functional Context: Redox regulation of ATP synthase , plant stress responses .

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: Standard shipping includes blue ice packs. Dry ice shipping is available upon request and incurs an additional charge. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.

If you require a specific tag, please inform us; we will prioritize developing your specified tag.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Atropa belladonna (Belladonna) (Deadly nightshade)
Target Names
atpI
Target Protein Sequence
MNVLSCSINTLKGLYDISGVEVGQHFYWQIGGFQVHGQVLITSWVVIAILLGSATIAVRN PQTIPTGGQNFFEYVLEFIRDVSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALLTSVAYFYAGLTKKGLGYFGKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMLLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function
A key component of the proton channel, directly involved in proton translocation across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is ATP synthase subunit a, chloroplastic (atpI) in Atropa belladonna and what is its function?

ATP synthase subunit a, chloroplastic (atpI) is a critical component of the chloroplast ATP synthase complex in Atropa belladonna (deadly nightshade). The full-length protein consists of 247 amino acids and plays an essential role in the proton translocation mechanism that drives ATP synthesis in chloroplasts.

The atpI protein forms part of the membrane-embedded Fo portion of the ATP synthase complex, which works in conjunction with the F1 portion to convert the energy from proton gradients into chemical energy in the form of ATP. This process is fundamental to photosynthetic metabolism in the chloroplasts of A. belladonna.

Specifically, atpI contributes to the proton channel that allows H+ ions to flow from the thylakoid lumen to the stroma along an electrochemical gradient. This proton flow drives the rotation of the c-subunit ring, which is mechanically coupled to ATP synthesis through the rotation of the γ-stalk in the F1 region of the complex .

How does atpI from A. belladonna relate to the evolutionary history of this ancient polyploid species?

A. belladonna is an ancient allohexaploid species that originated approximately 10-15 million years ago through hybridization between a tetraploid species of Hyoscyameae and an extinct diploid species that was sister to the tetraploid lineage . This complex evolutionary history has implications for understanding the genetic origins of its proteins, including atpI.

The study of genes like atpI in A. belladonna provides insights into how gene evolution proceeds following polyploidization events. While the search results don't specifically discuss the evolutionary dynamics of atpI, research on ribosomal DNA in A. belladonna demonstrates that different molecular mechanisms can achieve sequence unification in ancient hybrid species .

For chloroplast genes like atpI, inheritance typically follows maternal lineage, which may provide clues about which parental species contributed the chloroplast genome to A. belladonna. Comparative analysis of atpI sequences between A. belladonna and related species could potentially reveal patterns of sequence conservation or divergence that reflect its evolutionary history .

What are the optimal expression systems for recombinant production of A. belladonna atpI?

Based on available data, Escherichia coli is the preferred expression system for recombinant production of A. belladonna atpI. Specifically, E. coli BL21(DE3) strain has been successfully used for the expression of recombinant proteins from A. belladonna .

Recommended expression systems and strategies:

Expression SystemStrainVector TypeTagsAdvantages
E. coliBL21(DE3)pET-basedN-terminal His-tagHigh yield, IPTG inducible, established purification methods
E. coliT7 Express lysY/IqpMAL-c2xMBP fusionEnhanced solubility for difficult-to-express proteins
E. coliBL21(DE3)pET with chaperonesHis-tag with co-expressed chaperonesImproved folding, reduced toxicity

For membrane proteins like atpI that may present expression challenges, co-expression with molecular chaperones such as DnaK, DnaJ, and GrpE can significantly increase recombinant protein yields by improving protein folding and reducing toxicity .

The choice between these systems should be guided by the specific research requirements, particularly considering whether the native membrane-associated properties of atpI need to be preserved or if soluble protein fragments are sufficient for the intended application .

What cloning strategies are most effective for A. belladonna atpI expression constructs?

Effective cloning strategies for A. belladonna atpI should consider codon optimization, vector selection, and fusion partner design. Based on protocols for similar proteins, the following approach is recommended:

  • Gene synthesis and codon optimization: For optimal expression in E. coli, the A. belladonna atpI gene should be codon-optimized to match E. coli codon usage preferences. This minimizes translation issues and improves protein yield .

  • Vector selection: Several vectors have proven effective for the expression of plant proteins in E. coli:

    • pET-based vectors with T7 promoters for high-level expression

    • pMAL-c2x vectors for MBP fusion proteins that enhance solubility

    • Vectors with tightly regulated promoters to minimize toxicity from membrane protein expression

  • Restriction enzyme selection: Carefully choose restriction enzymes that are not present in the atpI gene sequence. Common combinations include NdeI/XhoI or EcoRI/HindIII for directional cloning .

  • Fusion partners and tags: For atpI, the addition of an N-terminal His-tag has been successfully employed for purification purposes. Other beneficial fusion partners include:

    • MBP (maltose-binding protein) to enhance solubility

    • SUMO or GST tags that can be precisely removed after purification

    • Fluorescent tags like EGFP or mCherry if visualization is needed

  • Verification: Following cloning, verify the correct insertion and sequence using colony PCR and DNA sequencing to ensure no mutations were introduced .

What induction protocols yield optimal expression of recombinant A. belladonna atpI in E. coli?

Optimal induction protocols for recombinant A. belladonna atpI expression in E. coli should be carefully tuned to balance protein yield with proper folding, especially given its nature as a membrane protein. Based on protocols for similar proteins, the following induction parameters are recommended:

Recommended induction conditions:

ParameterOptimal RangeNotes
Temperature16-25°CLower temperatures reduce inclusion body formation; 18°C often optimal for membrane proteins
IPTG concentration0.1-0.5 mMLower concentrations favor proper folding
Induction duration4-18 hoursLonger times at lower temperatures
OD600 at induction0.6-0.8Mid-log phase provides balance between cell density and expression capacity
MediaLB or TB with supplementsAddition of glucose (0.5-1%) may help reduce leaky expression

For challenging membrane proteins like atpI, co-expression with molecular chaperones (DnaK, DnaJ, and GrpE) can significantly improve yield and solubility. This requires co-transformation with a chaperone-expressing plasmid such as pOFXT7KJE3 .

Additionally, the use of specialized E. coli strains like T7 Express lysY/Iq can provide better control over expression by reducing basal transcription and protecting against potential toxicity of the recombinant protein .

What are the most effective purification methods for recombinant A. belladonna atpI?

Purification of recombinant A. belladonna atpI requires specialized techniques due to its hydrophobic nature as a membrane protein. Based on the available information and protocols for similar proteins, the following purification strategy is recommended:

Step-by-step purification protocol:

  • Cell lysis: Use either sonication or high-pressure homogenization in a buffer containing detergents suitable for membrane proteins (e.g., n-dodecyl β-D-maltoside (DDM) or Triton X-100) to solubilize the membrane-embedded protein .

  • Initial clarification: Centrifuge at 10,000-20,000 × g to remove cell debris while keeping the solubilized membrane fraction.

  • Immobilized Metal Affinity Chromatography (IMAC): Utilize the N-terminal His-tag for purification using Ni-NTA resin. For His-tagged atpI, the following conditions are optimal:

    • Binding buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 0.1% detergent, 10 mM imidazole

    • Wash buffer: Same as binding buffer with 20-40 mM imidazole

    • Elution buffer: Same as binding buffer with 250-500 mM imidazole

  • Size exclusion chromatography: Further purify the protein using gel filtration to remove aggregates and obtain homogeneous protein preparations.

  • Detergent exchange or reconstitution: Depending on the downstream application, exchange the detergent or reconstitute the protein into lipid vesicles or nanodiscs for functional studies.

This purification approach typically yields greater than 90% purity as determined by SDS-PAGE analysis . For structural studies or applications requiring extremely pure protein, additional chromatographic steps such as ion exchange chromatography may be necessary.

How can researchers verify the structural integrity and functionality of purified recombinant atpI?

Verifying the structural integrity and functionality of purified recombinant A. belladonna atpI requires a combination of biochemical, biophysical, and functional assays. The following approaches are recommended:

Structural integrity assessment:

  • SDS-PAGE and western blotting: Confirm protein size and purity using SDS-PAGE, and verify identity using western blotting with anti-His antibodies or specific antibodies against atpI .

  • Circular dichroism (CD) spectroscopy: Analyze secondary structure content to confirm proper folding, particularly the α-helical content expected for membrane proteins like atpI.

  • Limited proteolysis: Properly folded proteins typically show distinct proteolytic patterns compared to misfolded variants.

  • Mass spectrometry: Verify the intact mass and sequence coverage through peptide mapping to confirm the full-length protein is present without modifications or truncations.

Functional assessment:

  • Reconstitution into liposomes: Incorporate purified atpI into liposomes and measure proton translocation using pH-sensitive fluorescent dyes.

  • Co-purification assays: Test the ability of purified atpI to interact with other ATP synthase subunits, particularly the c-subunit ring which is essential for proton translocation .

  • ATP synthesis assays: Reconstitute atpI with other ATP synthase components and measure ATP synthesis rates under proton gradient conditions.

The combination of these techniques provides a comprehensive assessment of both the structural integrity and functional capacity of the purified recombinant atpI protein.

What strategies can address solubility challenges with recombinant A. belladonna atpI?

As a membrane protein, A. belladonna atpI presents significant solubility challenges during recombinant expression and purification. The following strategies can effectively address these challenges:

Expression-level strategies:

  • Fusion partners: Utilize solubility-enhancing fusion tags such as MBP (maltose-binding protein), SUMO, or GST. The pMAL-c2x vector system has been shown to improve solubility of difficult-to-express proteins .

  • Co-expression with chaperones: Co-transform expression cells with the pOFXT7KJE3 plasmid that expresses the chaperone proteins DnaK, DnaJ, and GrpE to facilitate proper folding and reduce aggregation .

  • Lower expression temperatures: Reduce induction temperature to 16-18°C and extend expression time to favor proper folding over rapid accumulation.

Extraction and purification strategies:

  • Optimized detergent selection: Test a panel of detergents including:

    • Mild detergents: n-dodecyl β-D-maltoside (DDM), digitonin

    • Non-ionic detergents: Triton X-100, Nonidet P-40

    • Zwitterionic detergents: CHAPS, Fos-choline-12

  • Detergent screening matrix:

DetergentCMC (mM)Working ConcentrationBest For
DDM0.170.5-1%Maintaining native structure
Triton X-1000.2-0.91-2%High extraction efficiency
CHAPS6-100.5-1%Preserving protein-protein interactions
SDS7-100.1-0.5%Complete denaturation (for analysis only)
  • Membrane fractionation: Isolate membrane fractions before detergent solubilization to enhance purity and reduce contaminants.

  • Solubilization additives: Include stabilizing agents in buffers:

    • Glycerol (10-20%) to stabilize hydrophobic regions

    • Arginine (50-100 mM) to reduce aggregation

    • Specific lipids that might be required for proper folding and function

  • Alternative solubilization approaches: For particularly recalcitrant preparations, consider:

    • Amphipol replacement of detergents for increased stability

    • Nanodisc incorporation for a more native-like membrane environment

    • Styrene-maleic acid copolymer (SMA) extraction that preserves the native lipid environment

How can recombinant A. belladonna atpI be used to study energy metabolism in chloroplasts?

Recombinant A. belladonna atpI provides valuable tools for investigating energy metabolism in chloroplasts, particularly the mechanisms of ATP synthesis. Several research applications include:

  • Proton translocation studies: Recombinant atpI can be reconstituted into liposomes to study its role in proton channel formation and the coupling of proton movement to ATP synthesis. This allows researchers to measure proton/ATP ratios and understand energy conversion efficiency .

  • Structure-function analysis: Through site-directed mutagenesis of the recombinant atpI, researchers can identify critical residues involved in proton translocation. Comparing the effects of mutations on proton movement and ATP synthesis can elucidate the molecular mechanism of the ATP synthase complex.

  • Interaction studies with c-subunit ring: The relationship between atpI and the c-subunit ring is crucial for understanding ATP synthase function. The c-subunit ring's stoichiometry can vary between species, affecting the proton/ATP ratio. As described in the research on spinach ATP synthase: "The rotation of the c-subunit ring is driven by the translocation of protons across this membrane, along an electrochemical gradient. The ratio of protons translocated to ATP synthesized varies according to the number of c-subunits" .

  • Comparative studies across species: Recombinant atpI from A. belladonna can be compared with homologs from other plant species to investigate evolutionary adaptations in energy metabolism, particularly in relation to A. belladonna's unique evolutionary history as an ancient allohexaploid .

  • Reconstitution of partial or complete ATP synthase complexes: By combining recombinant atpI with other ATP synthase subunits, researchers can reconstitute functional subcomplexes or complete ATP synthase assemblies for mechanistic studies of the entire complex.

What approaches are effective for studying protein-protein interactions involving atpI in the ATP synthase complex?

Understanding protein-protein interactions involving atpI is crucial for elucidating the structure and function of the ATP synthase complex. The following methodological approaches are effective for such studies:

  • Co-immunoprecipitation with tagged recombinant proteins:

    • Express His-tagged atpI along with other ATP synthase subunits

    • Perform pull-down assays using Ni-NTA resin

    • Identify interacting partners through western blotting or mass spectrometry

  • Crosslinking studies:

    • Use chemical crosslinkers of varying lengths to capture transient interactions

    • Apply photo-activatable crosslinkers for spatial precision

    • Identify crosslinked peptides using mass spectrometry to map interaction interfaces

  • Fluorescence-based interaction assays:

    • Fuse atpI and potential interaction partners with fluorescent proteins (EGFP, mCherry)

    • Measure interactions using Förster Resonance Energy Transfer (FRET)

    • Apply fluorescence recovery after photobleaching (FRAP) to assess dynamics of interactions in membrane systems

  • Bimolecular Fluorescence Complementation (BiFC):

    • Split a fluorescent protein between atpI and potential interaction partners

    • Reconstitution of fluorescence indicates protein-protein interaction

    • This approach is particularly valuable for visualizing interactions in chloroplast membranes

  • Surface Plasmon Resonance (SPR) or Microscale Thermophoresis (MST):

    • Quantitatively measure binding affinities between atpI and other subunits

    • Determine kinetic parameters of association and dissociation

    • These techniques require purified recombinant proteins in detergent micelles or nanodiscs

  • Native gel electrophoresis:

    • Blue native PAGE to preserve protein complexes during separation

    • Clear native PAGE for more sensitive detection of interactions

    • Two-dimensional approaches combining native PAGE with SDS-PAGE for subunit identification

These techniques can reveal critical interactions between atpI and other components of the ATP synthase complex, particularly with the c-subunit ring which is essential for proton translocation and energy conversion .

How does understanding A. belladonna atpI contribute to broader research on plant energy metabolism adaptations?

Research on A. belladonna atpI offers unique insights into plant energy metabolism adaptations due to several factors:

  • Evolutionary significance: As an ancient allohexaploid species that originated 10-15 million years ago, A. belladonna represents a valuable model for understanding how energy metabolism adapts following genome duplication and hybridization events . The study of atpI can reveal how chloroplast genes are maintained or modified through these evolutionary processes.

  • Specialized metabolism integration: A. belladonna is known for producing tropane alkaloids like atropine and scopolamine, which requires significant metabolic resources . Understanding how energy metabolism through ATP synthase supports or interfaces with specialized metabolism pathways can reveal adaptations specific to medicinal plants.

  • Stoichiometric variations: Research on ATP synthase has shown that the c-subunit ring, which works in conjunction with atpI, can vary in stoichiometry across species: "The ratio of protons translocated to ATP synthesized varies according to the number of c-subunits" . Investigating whether A. belladonna has specific adaptations in its ATP synthase complex can provide insights into energy efficiency adaptations.

  • Environmental adaptation: Comparative studies of atpI across Solanaceae species growing in different environments can reveal adaptations in energy metabolism related to stress tolerance. A. belladonna's ability to thrive in various conditions may be partly explained by adaptations in its energy-generating machinery.

  • Applied research potential: Understanding the unique properties of A. belladonna atpI could potentially inform bioengineering efforts to enhance photosynthetic efficiency or stress tolerance in crops, particularly those related to Solanaceae family members like tomato, potato, and eggplant.

What are common expression and purification challenges with recombinant A. belladonna atpI and how can they be resolved?

Recombinant expression and purification of A. belladonna atpI presents several challenges typical of membrane proteins. The following table outlines common issues and their solutions:

ChallengePossible CausesSolutions
Low expression levelsProtein toxicity, codon bias, promoter leakinessUse tightly regulated expression systems (T7 Express lysY/Iq strain), codon optimization, lower induction temperature (16-18°C)
Inclusion body formationRapid expression, improper folding, hydrophobic interactionsCo-express with chaperones (DnaK, DnaJ, GrpE using pOFXT7KJE3 plasmid), reduce IPTG concentration (0.1-0.3 mM), express as fusion with solubility-enhancing tags
Poor solubilizationInadequate detergent selection, insufficient extraction timeScreen multiple detergents (DDM, Triton X-100, CHAPS), optimize detergent concentration, extend solubilization time (overnight at 4°C)
Protein degradationProtease activity, protein instabilityAdd protease inhibitors, maintain samples at 4°C, include stabilizing agents (glycerol, specific lipids)
Low binding to Ni-NTAHis-tag inaccessibility, improper buffer conditionsOptimize imidazole concentration in binding buffer (5-10 mM), adjust pH (7.5-8.0), ensure detergent concentration above CMC
Protein aggregation after purificationDetergent removal, concentration-induced aggregationMaintain detergent above CMC, use stabilizing additives (glycerol, arginine), avoid excessive concentration

The co-expression with chaperone proteins has been shown to be particularly effective: "The co-expression of these chaperone proteins has been shown to substantially increase quantities of recombinant proteins which are toxic or otherwise difficult to produce" . This approach should be considered as a primary strategy when difficulties in expression are encountered.

How can researchers optimize recombinant atpI for structural studies?

Optimizing recombinant A. belladonna atpI for structural studies requires specific strategies to enhance protein stability, homogeneity, and behavior in various structural biology techniques:

  • Construct optimization for crystallography:

    • Remove flexible regions through limited proteolysis followed by mass spectrometry to identify stable domains

    • Engineer thermostable variants through directed evolution or consensus-based design

    • Consider fusion with crystallization chaperones like T4 lysozyme or BRIL in loop regions

  • Sample preparation for cryo-electron microscopy:

    • Test multiple detergents and amphipols for optimal particle dispersion

    • Consider reconstitution into nanodiscs with defined lipid composition

    • Optimize buffer conditions (pH, salt concentration) to prevent aggregation

  • NMR spectroscopy optimization:

    • Produce isotopically labeled protein (15N, 13C) using minimal media

    • Consider selective labeling of specific amino acids to simplify spectra

    • Test different detergent micelles for optimal spectral quality

  • Lipid environment considerations:

    • Screen native-like lipid compositions for reconstitution

    • Test the addition of specific lipids that may be required for structural stability

    • Consider styrene-maleic acid lipid particles (SMALPs) to maintain native lipid environment

  • Homogeneity enhancement:

    • Apply rigorous size exclusion chromatography as the final purification step

    • Use analytical ultracentrifugation to verify sample monodispersity

    • Consider fluorescence-detection size exclusion chromatography (FSEC) for screening optimal conditions before large-scale purification

These approaches should be implemented systematically, with small-scale screening before scaling up to the quantities required for structural studies. Additionally, stability assays such as differential scanning fluorimetry can help identify optimal buffer conditions for maintaining protein stability during structural studies .

What experimental controls are essential when working with recombinant A. belladonna atpI?

When working with recombinant A. belladonna atpI, implementing appropriate experimental controls is crucial for ensuring reliable and interpretable results. The following controls should be considered essential:

  • Expression controls:

    • Empty vector control: Cells transformed with expression vector lacking the atpI gene to identify background proteins

    • Uninduced control: Expression cultures without inducer addition to assess leaky expression

    • Toxic protein control: Expression of a known well-expressed protein (e.g., GFP) to confirm expression system functionality

  • Purification controls:

    • Mock purification: Perform purification procedure with lysate from empty vector control cells

    • Known protein standard: Purify a well-characterized His-tagged protein to validate purification protocol

    • Negative control for binding specificity: Include samples without His-tag to confirm binding specificity

  • Functional assay controls:

    • Denatured protein control: Heat-denatured atpI to confirm activity requires native protein structure

    • Inhibitor controls: Use specific ATP synthase inhibitors (oligomycin, DCCD) to confirm observed activity is specific

    • Reconstitution controls: Empty liposomes and liposomes with control membrane proteins to establish baseline measurements

  • Interaction study controls:

    • Non-interacting protein control: Include unrelated His-tagged protein in pull-down assays

    • Competition controls: Use unlabeled protein to compete with labeled protein in binding studies

    • Negative control constructs: Mutated versions of atpI with disrupted interaction interfaces

  • Analytical controls:

    • Molecular weight markers for SDS-PAGE and western blotting

    • Positive and negative antibody controls for immunodetection

    • Buffer-only controls for spectroscopic measurements

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.