Recombinant Atropa belladonna ATP synthase subunit b, chloroplastic (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; ATP synthase subunit b, chloroplastic; ATP synthase F(0 sector subunit b; ATPase subunit I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-184
Protein Length
full length protein
Species
Atropa belladonna (Belladonna) (Deadly nightshade)
Target Names
atpF
Target Protein Sequence
MKNVTDSFVSLGHWPSAGSFGFNTDILATNPINLSVVLGVLIFFGKGVLSDLLDNRKQRI LNTIRNSEELREGAIEQLEKARSRLRKVETEAEQFRVNGYSEIEREKLNLINSTYKTLEQ LENYKNETIQFEQQRAINQVRQRVFQQALRGALGTLNSCLNNELHLRTISANIGMLGTMK EITD
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: F(1), the extramembranous catalytic core, and F(0), the membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled, via a rotary mechanism of the central stalk subunits, to proton translocation. This protein is a component of the F(0) channel and forms part of the peripheral stalk, connecting F(1) to F(0).
Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Atropa belladonna ATP synthase subunit b and its significance in photosynthesis research?

Atropa belladonna ATP synthase subunit b (atpF) is a critical component of the chloroplastic ATP synthase complex, which plays a central role in energy production during photosynthesis. The chloroplast ATP synthase utilizes the electrochemical proton gradient generated during photosynthesis to synthesize ATP, the universal energy currency in cells. The ATP synthase consists of two major components: the membrane-embedded F₀ motor and the catalytic F₁ head, with the b subunit forming part of the peripheral stalk that connects these components .

Research on this protein is significant because it provides insights into the fundamental mechanisms of energy conversion in plants, particularly in Atropa belladonna (deadly nightshade), a medicinal plant with significant pharmacological relevance. The study of chloroplastic ATP synthase components contributes to our understanding of plant bioenergetics and potentially informs strategies for improving photosynthetic efficiency.

How is recombinant A. belladonna ATP synthase subunit b typically expressed and purified for research purposes?

Recombinant A. belladonna ATP synthase subunit b is typically expressed in E. coli expression systems, similar to other chloroplastic proteins such as the ATP synthase subunit c from the same species . The expression process involves:

  • Cloning the atpF gene into an appropriate expression vector

  • Transforming the construct into a compatible E. coli strain

  • Inducing protein expression under optimized conditions

  • Harvesting cells and lysing to release the recombinant protein

  • Purifying using affinity chromatography (typically with His-tag purification systems)

The purified protein is often supplied as a lyophilized powder and requires proper reconstitution before use. Researchers typically reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL, often with the addition of glycerol (5-50% final concentration) for long-term storage . Aliquoting is necessary to avoid repeated freeze-thaw cycles that can compromise protein integrity.

What are the optimal storage conditions for recombinant A. belladonna atpF protein to maintain functionality?

Optimal storage conditions for recombinant A. belladonna atpF protein typically mirror those established for similar chloroplastic proteins from the same species. Based on protocols for related proteins, researchers should:

  • Store the lyophilized powder at -20°C/-80°C upon receipt

  • After reconstitution, store working aliquots at 4°C for no more than one week

  • For long-term storage, maintain aliquots at -20°C/-80°C with glycerol as a cryoprotectant

  • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity

  • Use storage buffers with stabilizing agents such as Tris/PBS-based buffers with approximately 6% trehalose at pH 8.0

Researchers should validate these conditions specifically for atpF, as storage requirements may vary between different ATP synthase subunits depending on their structural characteristics and stability profiles.

How can I design functional assays to evaluate the ATP synthesis activity of recombinant A. belladonna atpF in reconstituted systems?

Designing functional assays for recombinant A. belladonna atpF requires careful consideration of its role within the ATP synthase complex. Since atpF (subunit b) is part of the peripheral stalk rather than the catalytic domain, functional assays typically involve:

  • Reconstitution of the complete ATP synthase complex:

    • Combine purified atpF with other ATP synthase subunits

    • Incorporate the complex into liposomes or nanodiscs to mimic the membrane environment

    • Establish a proton gradient across the membrane

  • ATP synthesis activity measurement:

    • Create a proton motive force using techniques such as acid-base transition or light-driven proton pumps

    • Measure ATP production using luciferase-based assays or HPLC-based detection

    • Compare activity with and without the recombinant atpF to assess its contribution

  • Structural integrity evaluation:

    • Use circular dichroism to verify proper folding

    • Employ size-exclusion chromatography to confirm complex assembly

    • Apply negative-stain or cryo-electron microscopy to visualize the assembled complex

The peripheral stalk, including subunit b, redistributes differences in torsional energy across the rotation cycle of ATP synthase , so assays that can measure the efficiency and stability of rotation would be particularly informative.

What are the best approaches for studying protein-protein interactions between atpF and other ATP synthase subunits?

To investigate protein-protein interactions between atpF and other ATP synthase subunits, researchers can employ multiple complementary techniques:

  • Co-immunoprecipitation (Co-IP):

    • Use antibodies specific to atpF or other subunits

    • Analyze precipitated complexes by SDS-PAGE and western blotting

    • Identify interacting partners by mass spectrometry

  • Yeast two-hybrid (Y2H) screening:

    • Create fusion constructs of atpF and potential binding partners

    • Evaluate interactions based on reporter gene activation

    • Validate positive interactions with deletion mutants to map binding domains

  • Surface plasmon resonance (SPR):

    • Immobilize purified atpF on a sensor chip

    • Measure binding kinetics with other purified ATP synthase subunits

    • Determine association and dissociation constants

  • Chemical cross-linking coupled with mass spectrometry:

    • Use bifunctional cross-linkers to capture transient interactions

    • Digest cross-linked complexes and analyze by MS

    • Map interaction interfaces based on cross-linked peptides

  • Fluorescence resonance energy transfer (FRET):

    • Label atpF and potential partners with appropriate fluorophores

    • Measure energy transfer as evidence of proximity

    • Perform in vitro or in vivo depending on experimental goals

These approaches can provide detailed insights into how atpF contributes to the structural integrity and functional dynamics of the ATP synthase complex.

What control experiments should be included when working with recombinant A. belladonna atpF protein?

When working with recombinant A. belladonna atpF protein, rigorous control experiments are essential to ensure reliable results:

Control TypePurposeImplementation
Negative ControlsEstablish baseline and rule out false positives- Empty vector-transformed E. coli lysates
- Irrelevant proteins with similar tags
- Assays without added atpF protein
Positive ControlsValidate assay functionality- Known functional ATP synthase complexes
- Commercial ATP synthase preparations
- Previously characterized atpF from related species
Stability ControlsMonitor protein degradation- Time-course analysis of protein integrity
- Western blots to detect degradation products
- Activity assays at different time points
Tag ControlsAssess tag interference- Compare tagged vs. untagged proteins
- Test different tag positions (N- vs. C-terminal)
- Include tag-cleaved protein preparations
Species Specificity ControlsEvaluate unique features of A. belladonna atpF- Compare with homologous proteins from other plants
- Use chimeric proteins with domains from different species

Additionally, researchers should conduct parallel experiments with atpF mutants that alter key functional residues to establish structure-function relationships. For proteins expressed in E. coli, endotoxin removal and verification should be performed before functional assays to prevent confounding effects in certain experimental systems .

How can genetic engineering approaches be used to modify atpF function in A. belladonna for enhanced plant bioenergetics?

Genetic engineering of atpF in A. belladonna presents unique opportunities for enhancing plant bioenergetics through several sophisticated approaches:

  • Site-directed mutagenesis of key residues:

    • Modify amino acids involved in subunit interactions to strengthen complex stability

    • Alter residues that contribute to proton translocation efficiency

    • Engineer pH-responsive elements to optimize function under varying conditions

  • Chimeric protein design:

    • Create fusion proteins incorporating high-efficiency domains from other species

    • Generate hybrid stalks with altered flexibility to optimize energy transfer

    • Develop synthetic variants with novel regulatory features

  • Transgenic expression strategies in planta:

    • Use tissue-specific or inducible promoters to control atpF expression

    • Co-express with other modified ATP synthase components for coordinated enhancement

    • Incorporate regulatory elements responsive to metabolic status

The successful genetic engineering of A. belladonna has already been demonstrated for other traits, as seen in the development of transgenic homozygous lines with enhanced tropane alkaloid production and glyphosate resistance . Similar approaches could be applied to atpF modification, potentially coupling improvements in ATP synthase efficiency with other beneficial traits.

For effective transformation, researchers should consider the specific challenges of A. belladonna cultivation, including seed dormancy issues and the need for sterile soil conditions during seedling development , which might affect regeneration protocols for transgenic plants.

What is the relationship between ATP synthase function and tropane alkaloid biosynthesis in A. belladonna?

The relationship between ATP synthase function and tropane alkaloid biosynthesis in A. belladonna represents a critical intersection of energy metabolism and specialized metabolite production:

  • Energetic requirements:

    • Tropane alkaloid biosynthesis is energy-intensive, requiring ATP for multiple steps

    • Enhanced ATP synthase efficiency could potentially increase alkaloid yields

    • The energy status of the plant may serve as a regulatory input for alkaloid production

  • Regulatory connections:

    • Calmodulin-mediated signaling affects both ATP synthase regulation and alkaloid biosynthesis

    • The novel calmodulin gene (AbCaM1) identified in A. belladonna significantly upregulates key tropane alkaloid biosynthesis genes

    • ATP synthase activity may influence cellular calcium homeostasis, indirectly affecting calmodulin-dependent processes

  • Subcellular compartmentation:

    • Chloroplasts provide energy and precursors for specialized metabolism

    • Altered ATP synthase function may affect metabolite export from chloroplasts

    • Coordination between organelles is essential for efficient alkaloid production

Engineering approaches that target atpF alongside calmodulin genes could potentially create synergistic effects, enhancing both energy production and alkaloid biosynthesis. The transgenic A. belladonna lines with enhanced alkaloid production could serve as valuable models for investigating these relationships, particularly by examining ATP synthase composition and function in these high-producing lines.

How does the structure of A. belladonna atpF compare with homologous proteins from other medicinal plants, and what are the functional implications?

Comparative structural analysis of A. belladonna atpF with homologous proteins from other medicinal plants reveals important evolutionary adaptations with significant functional implications:

  • Sequence conservation patterns:

    • Core functional domains typically show high conservation across plant species

    • Species-specific variations often cluster in regions involved in regulatory interactions

    • A. belladonna-specific residues may correlate with its unique metabolic profile

  • Structural elements comparison:

    • The peripheral stalk architecture, including atpF, redistributes torsional energy across the ATP synthase rotation cycle

    • Species-specific variations in peripheral stalk flexibility may optimize energy capture under different environmental conditions

    • Regulatory elements, such as redox-sensitive motifs, may differ between species based on ecological adaptations

  • Functional correlations:

    • Differences in ATP synthase efficiency between species often correlate with habitat-specific energetic requirements

    • Medicinal plants with high specialized metabolite production may show adaptations in ATP synthase components to support these demanding biosynthetic pathways

    • A. belladonna's adaptation to various environmental conditions may be reflected in unique regulatory features of its ATP synthase components

A detailed understanding of these structural comparisons could inform biotechnological approaches to engineer ATP synthase components with enhanced properties for specific applications in medicinal plant biotechnology.

What are the most effective protocols for analyzing post-translational modifications of recombinant A. belladonna atpF?

Analyzing post-translational modifications (PTMs) of recombinant A. belladonna atpF requires a multi-faceted analytical approach:

  • Mass spectrometry-based proteomics:

    • Bottom-up proteomics: Digest protein with trypsin or other proteases, analyze resulting peptides by LC-MS/MS

    • Top-down proteomics: Analyze intact protein to preserve modification patterns

    • Targeted approaches: Multiple reaction monitoring (MRM) for known modifications

    • Enrichment strategies: Phosphopeptide enrichment using TiO₂ or IMAC for phosphorylation analysis

  • Modification-specific detection methods:

    • Western blotting with modification-specific antibodies (phospho, acetyl, etc.)

    • ProQ Diamond staining for phosphorylation

    • Periodic acid-Schiff staining for glycosylation

    • Biotin-switch techniques for redox-sensitive modifications

  • Functional correlation studies:

    • Site-directed mutagenesis of modified residues

    • In vitro modification/demodification experiments with purified enzymes

    • Comparison of plant-derived versus recombinant protein modification patterns

For chloroplast proteins like atpF, redox-sensitive modifications are particularly relevant, as exemplified by the β-hairpin redox switch identified in subunit γ of plant ATP synthase that regulates activity in response to light conditions . Similar regulatory mechanisms may exist in atpF and should be carefully investigated.

How can cryo-electron microscopy be optimized for structural studies of A. belladonna ATP synthase complexes containing recombinant atpF?

Optimizing cryo-electron microscopy (cryo-EM) for structural studies of A. belladonna ATP synthase complexes requires addressing several technical challenges:

  • Sample preparation optimization:

    • Purify intact ATP synthase complexes incorporating recombinant atpF

    • Test different detergents and nanodiscs for membrane protein stabilization

    • Optimize protein concentration and buffer conditions to prevent aggregation

    • Evaluate grid types and glow discharge parameters for optimal particle distribution

  • Data collection strategies:

    • Implement beam-induced motion correction for high-resolution imaging

    • Use energy filters to enhance contrast of the relatively small peripheral stalk

    • Collect tilt series to address preferred orientation issues common with membrane proteins

    • Employ phase plates for improved contrast of small features

  • Image processing considerations:

    • Apply focused classification approaches to resolve heterogeneity in peripheral stalk regions

    • Use masked refinement to enhance resolution of the atpF-containing peripheral stalk

    • Implement symmetry-based approaches when appropriate

    • Integrate molecular dynamics simulations with cryo-EM data for regions with high flexibility

Recent high-resolution structures of complete chloroplast ATP synthase complexes have successfully resolved sidechains of all protein subunits and identified the proton pathway to and from the rotor ring . Similar approaches, adapted specifically for the A. belladonna complex, could provide valuable insights into species-specific structural features of atpF and its interactions within the ATP synthase complex.

What advanced metabolomic approaches can reveal the impact of atpF modifications on plant energy metabolism and secondary metabolite production?

Advanced metabolomic approaches can provide comprehensive insights into the impact of atpF modifications on both primary energy metabolism and specialized metabolite production in A. belladonna:

  • Integrated multi-omics strategies:

    • Combine untargeted metabolomics with transcriptomics and proteomics

    • Correlate changes in ATP/ADP ratios with metabolic flux redirections

    • Map changes to tropane alkaloid biosynthetic pathways using 13C-labeling studies

    • Apply network analysis to identify metabolic hubs affected by atpF modifications

  • Spatially-resolved approaches:

    • Utilize laser-capture microdissection coupled with metabolite analysis

    • Apply MALDI-imaging mass spectrometry to visualize metabolite distributions

    • Implement single-cell metabolomics for cell-type specific responses

    • Compare metabolite profiles across different plant tissues and organelles

  • Temporal dynamics assessment:

    • Perform time-course experiments to capture dynamic metabolic responses

    • Analyze diurnal variations in energy metabolism and alkaloid production

    • Study developmental stage-specific metabolic shifts

    • Evaluate stress response kinetics in wild-type versus atpF-modified plants

These approaches can be particularly powerful when applied to transgenic A. belladonna lines, such as those with enhanced tropane alkaloid production capabilities . For instance, comprehensive metabolomic analysis of the transgenic homozygous lines T2GC02, T2GC05, and T2GC06, which produce significantly elevated levels of hyoscyamine (8.95-, 10.61-, and 9.96 mg/g DW) and scopolamine (1.34-, 1.50- and 0.86 mg/g DW) compared to wild-type plants , could reveal metabolic network adaptations that accommodate enhanced alkaloid production.

What are common pitfalls in recombinant atpF expression systems and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant atpF expression systems, each requiring specific troubleshooting approaches:

  • Low expression yields:

    • Optimize codon usage for E. coli or other expression hosts

    • Test different promoter systems (T7, tac, arabinose-inducible)

    • Evaluate expression in specialized strains designed for membrane proteins

    • Co-express with molecular chaperones to improve folding

    • Optimize induction conditions (temperature, inducer concentration, duration)

  • Protein misfolding and inclusion body formation:

    • Reduce expression temperature (16-20°C) to slow protein synthesis

    • Use solubility-enhancing fusion partners (MBP, SUMO, TrxA)

    • Optimize lysis buffer conditions to maintain protein solubility

    • Develop effective refolding protocols from inclusion bodies if necessary

    • Consider cell-free expression systems for difficult proteins

  • Protein instability after purification:

    • Screen buffer conditions systematically (pH, salt, additives)

    • Include stabilizing agents such as trehalose (6%) in storage buffers

    • Use proper aliquoting and avoid repeated freeze-thaw cycles

    • Store working aliquots at 4°C for no more than one week

    • Consider protein engineering approaches to enhance stability

  • Non-functional recombinant protein:

    • Verify correct disulfide bond formation

    • Assess post-translational modifications present in native but missing in recombinant protein

    • Test different expression hosts, including plant-based systems

    • Evaluate the impact of fusion tags on protein function

    • Co-express with interacting partners to stabilize native conformation

These approaches should be systematically evaluated and optimized for the specific challenges presented by A. belladonna atpF.

How can researchers address experimental variability when comparing wild-type and modified atpF in functional assays?

Addressing experimental variability when comparing wild-type and modified atpF requires rigorous experimental design and statistical approaches:

  • Standardized sample preparation:

    • Process all samples in parallel using identical protocols

    • Verify protein concentration using multiple methods (BCA, Bradford, absorbance)

    • Assess protein purity consistently (SDS-PAGE, size exclusion chromatography)

    • Prepare fresh working stocks from the same master aliquots

    • Conduct experiments with proteins from the same purification batch when possible

  • Robust experimental design:

    • Implement randomized block designs to distribute systematic errors

    • Include technical and biological replicates (minimum n=3 for each)

    • Blind sample identity during analysis to prevent unconscious bias

    • Incorporate positive and negative controls in each experimental series

    • Use multiple independent protein preparations to ensure reproducibility

  • Appropriate statistical analysis:

    • Perform power analysis to determine adequate sample sizes

    • Apply appropriate statistical tests based on data distribution

    • Use paired tests when comparing wild-type and modified proteins tested simultaneously

    • Implement ANOVA with post-hoc tests for multiple variant comparisons

    • Consider Bayesian approaches for complex experimental designs

  • Data normalization strategies:

    • Normalize to internal standards consistently applied across experiments

    • Use relative rather than absolute measurements when appropriate

    • Account for batch effects using statistical corrections

    • Implement quality control metrics for excluding outlier data points

    • Standardize assay conditions using well-characterized reference proteins

By implementing these approaches, researchers can minimize variability and increase confidence in the detected differences between wild-type and modified atpF proteins.

What strategies can overcome challenges in integrating recombinant atpF into functional ATP synthase complexes for mechanistic studies?

Integrating recombinant atpF into functional ATP synthase complexes presents significant challenges that can be addressed through several advanced strategies:

  • Co-expression approaches:

    • Design multi-cistronic expression constructs containing atpF with interacting subunits

    • Establish dual-plasmid systems with compatible origins of replication

    • Implement sequential induction protocols to optimize stoichiometry

    • Utilize specialized E. coli strains designed for membrane protein complex expression

    • Consider heterologous expression in chloroplast-containing organisms (e.g., Chlamydomonas)

  • In vitro reconstitution methods:

    • Develop step-wise assembly protocols with purified components

    • Optimize detergent selection for membrane component stabilization

    • Use lipid nanodiscs or liposomes to provide native-like membrane environments

    • Implement real-time monitoring of complex assembly using fluorescently labeled subunits

    • Apply mild cross-linking to stabilize transient intermediates

  • Hybrid complex formation:

    • Integrate recombinant atpF into partially purified native ATP synthase complexes

    • Use subcomplex complementation approaches to test specific interactions

    • Develop protocols for exchanging specific subunits in preformed complexes

    • Engineer affinity-tagged versions for monitoring integration efficiency

    • Implement FRET-based assays to confirm proper assembly

  • Functional verification approaches:

    • Establish sensitive ATP hydrolysis/synthesis assays for assembled complexes

    • Apply single-molecule techniques to monitor rotary dynamics

    • Use proton pumping assays in reconstituted liposomes to verify functionality

    • Implement electron microscopy to confirm structural integrity

    • Develop activity assays that specifically depend on peripheral stalk function

The flexible peripheral stalk, which includes atpF, plays a crucial role in redistributing torsional energy across the rotation cycle , making functional verification particularly important when working with recombinant or modified atpF proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.