Recombinant Atropa belladonna Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

General Information

  • Name: Recombinant Atropa belladonna Chloroplast Envelope Membrane Protein (cemA)

  • Source Organism: Atropa belladonna (Deadly nightshade)

  • Type: Recombinant Protein

  • Predicted function: The cemA protein is located in the chloroplast envelope and is likely involved in membrane transport or structural functions within the chloroplast .

Structure and Sequence

The cemA protein is located in the chloroplast envelope and is likely involved in membrane transport or structural functions within the chloroplast . The full-length Atropa belladonna cemA protein consists of 229 amino acids . The amino acid sequence, as provided by one supplier, is as follows :
MAKKKAFTPLFYLASIVFLPWWISFSVNKCLESWVTNWWNTGQSEIFLNNIQEKSLLEKFIELEELLLLDEMIKEYSETHLEEFGIGIHKETIQLIKIQNENRIHTILHFSTNIICFIILSGYSILGNEKLVILNSWAQEFLYNLSDTVKAFSILLLTDLCIGFHSPHGWELMIGSIYKD FGFVHNDQIISGLVSTFPVILDTIFKYWIFRYLNRLSPSLVVIYHSMND.

Function and Localization

The development of chloroplasts and the integration of their function within a plant cell rely on the presence of a complex biochemical machinery located within their limiting envelope membranes .

  • Subcellular Localization: Chloroplast envelope membrane

  • Function: Chloroplast envelope membrane proteins are crucial for various processes, including metabolite transport, protein import, and lipid metabolism .

Recombinant Production

Recombinant cemA protein is produced using molecular biology techniques, where the gene encoding cemA is inserted into a suitable expression vector and expressed in a host organism such as E. coli . Recombinant production allows for the generation of large quantities of the protein for research and industrial applications.

Applications

Recombinant Atropa belladonna Chloroplast Envelope Membrane Protein (cemA) and its antibodies are useful tools for studying chloroplast biology, plant physiology, and potentially for biotechnological applications .

  • ELISA assays: Recombinant cemA proteins can be used as standards or antigens in enzyme-linked immunosorbent assays (ELISA) to detect and quantify anti-cemA antibodies .

  • Protein Interaction Studies: Recombinant cemA can be used to identify interacting partners and study protein complex formation within the chloroplast envelope .

  • Structural Studies: Recombinant production allows for structural determination of cemA through X-ray crystallography or NMR spectroscopy, providing insights into its function .

  • Antibody Production: Recombinant cemA can be used as an antigen to generate specific antibodies for research applications such as western blotting, immunofluorescence, and immunoprecipitation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Atropa belladonna (Belladonna) (Deadly nightshade)
Target Names
cemA
Target Protein Sequence
MAKKKAFTPLFYLASIVFLPWWISFSVNKCLESWVTNWWNTGQSEIFLNNIQEKSLLEKF IELEELLLLDEMIKEYSETHLEEFGIGIHKETIQLIKIQNENRIHTILHFSTNIICFIIL SGYSILGNEKLVILNSWAQEFLYNLSDTVKAFSILLLTDLCIGFHSPHGWELMIGSIYKD FGFVHNDQIISGLVSTFPVILDTIFKYWIFRYLNRLSPSLVVIYHSMND
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is the chloroplast envelope membrane protein (cemA) in Atropa belladonna and what is its function?

The chloroplast envelope membrane protein (cemA) in Atropa belladonna is a membrane-bound protein located in the chloroplast envelope that plays a critical role in carbon dioxide uptake during photosynthesis. This protein facilitates CO₂ transport across the chloroplast membrane, which is essential for efficient photosynthetic carbon fixation. In A. belladonna, as in other plant species, cemA is encoded by the chloroplast genome and contributes to the complex biochemical machinery that regulates chloroplast function and development . The protein belongs to a broader category of envelope membrane proteins that collectively manage metabolite transport, protein import, and lipid metabolism in chloroplasts.

What are the challenges in isolating and expressing recombinant cemA protein from Atropa belladonna?

The isolation and expression of recombinant cemA protein from Atropa belladonna present several significant challenges:

  • Membrane protein solubility: As cemA is an integral membrane protein, it is highly hydrophobic and difficult to solubilize without disrupting its native conformation.

  • Expression system compatibility: Selecting an appropriate expression system that maintains protein functionality while providing sufficient yields is challenging.

  • Protein purification complexity: The isolation of pure cemA requires specialized extraction methods such as chloroform/methanol extraction, alkaline treatments, or saline treatments to retrieve hydrophobic proteins from membrane fractions .

  • Post-translational modifications: cemA may undergo specific post-translational modifications in A. belladonna that are difficult to replicate in heterologous expression systems.

  • Protein quality variability: Different expression and purification methods can lead to inconsistent protein quality, affecting downstream applications and experimental reproducibility .

How does cemA from Atropa belladonna compare to homologous proteins in other plant species?

While specific comparative data for cemA across different plant species is limited, chloroplast envelope membrane proteins show both conservation and diversity across plant species:

  • Functional conservation: The core function of cemA in CO₂ transport is generally conserved across photosynthetic organisms.

  • Sequence variation: Some sequence variations exist between A. belladonna cemA and those of other plants, potentially reflecting adaptations to different environmental conditions.

  • Interactome differences: The protein interaction networks involving cemA may differ between A. belladonna and other plant species based on their unique metabolic requirements.

  • Regulatory mechanisms: Expression and regulation patterns of cemA may vary between A. belladonna and other plants, particularly considering the specialized secondary metabolism of this medicinal plant.

Proteomic analyses of chloroplast envelope membranes have identified more than 100 proteins in Arabidopsis, with approximately 80% confirmed to be located in the chloroplast envelope . Similar comprehensive studies specifically for A. belladonna cemA would provide more precise comparative data.

What are the most effective protocols for recombinant expression of Atropa belladonna cemA?

For effective recombinant expression of A. belladonna cemA, researchers should consider the following protocol elements:

  • Expression system selection:

    • Bacterial systems (E. coli): Suitable for initial expression attempts due to simplicity and high yield, but may struggle with proper folding of membrane proteins.

    • Plant-based expression systems: Can provide more appropriate post-translational modifications and folding environment.

    • Cell-free expression systems: Useful for membrane proteins as they can incorporate detergents or lipids during synthesis.

  • Vector design considerations:

    • Include appropriate signal sequences for membrane targeting

    • Consider fusion tags that enhance solubility (MBP, SUMO)

    • Add affinity tags (His, FLAG) for purification while ensuring they don't interfere with protein function

  • Expression optimization:

    • Temperature modulation (typically lower temperatures of 16-20°C improve membrane protein folding)

    • Induction conditions (lower inducer concentrations with longer expression times)

    • Co-expression with chaperones to assist proper folding

  • Membrane extraction protocol:

    • Use of specialized buffers containing appropriate detergents (DDM, LDAO, or Triton X-100)

    • Sequential extraction methods similar to those used for chloroplast envelope proteins in Arabidopsis, employing chloroform/methanol extraction followed by alkaline or saline treatments

  • Quality control checkpoints:

    • SDS-PAGE analysis with Coomassie staining to assess purity

    • Western blotting for identity confirmation

    • Mass spectrometry for detailed characterization and post-translational modification analysis

How can researchers troubleshoot inconsistent results when working with recombinant cemA protein?

Inconsistent results when working with recombinant cemA protein can be methodically addressed through a systematic troubleshooting workflow:

  • Protein quality assessment:

    • Perform SDS-PAGE with Coomassie staining to evaluate protein integrity and purity

    • Implement GeLC-MS2 (gel electrophoresis followed by liquid chromatography-tandem mass spectrometry) to detect potential contaminants and post-translational modifications that might affect protein function

    • Verify protein identity through Western blotting or mass spectrometry

  • Storage and handling evaluation:

    • Assess protein stability under different storage conditions

    • Test for potential aggregation using dynamic light scattering

    • Document freeze-thaw effects on protein activity

  • Detergent and buffer optimization:

    • Systematically test different detergents for optimal cemA solubilization

    • Evaluate buffer compositions for pH and ionic strength effects

    • Consider adding stabilizing agents like glycerol or specific lipids

  • Experimental controls implementation:

    • Include positive and negative controls in all assays

    • Validate assay components independently

    • Perform parallel experiments with different protein lots

  • Assay condition standardization:

    • Standardize all experimental parameters including temperature, incubation times, and reagent concentrations

    • Create detailed standard operating procedures (SOPs) for all protocols

    • Consider the reproducibility framework described for recombinant protein-based assays to ensure quality control of reagents and prevent spurious or irreproducible data

This systematic approach can identify the source of variability and lead to more consistent experimental outcomes.

What purification strategies yield the highest purity cemA protein suitable for structural studies?

Obtaining high-purity cemA protein for structural studies requires specialized purification strategies:

  • Multi-step purification approach:

    • Initial capture: Immobilized metal affinity chromatography (IMAC) using His-tagged proteins

    • Intermediate purification: Ion exchange chromatography to separate based on charge differences

    • Polishing: Size exclusion chromatography to remove aggregates and achieve homogeneity

  • Detergent selection and exchange:

    • Initial extraction with stronger detergents (e.g., SDS, Triton X-100)

    • Gradual exchange to milder detergents (e.g., DDM, LMNG) more suitable for structural studies

    • Consideration of detergent-lipid mixed micelles to maintain native-like environment

  • Membrane protein-specific techniques:

    • Amphipol exchange for detergent-free stabilization

    • Reconstitution into nanodiscs or liposomes for a lipid bilayer environment

    • Application of lipid cubic phase techniques for crystallization trials

  • Quality validation methods:

    • Thermal stability assays to assess protein folding

    • Circular dichroism to verify secondary structure content

    • Single-particle electron microscopy to evaluate sample homogeneity

    • Mass spectrometry to confirm protein integrity and identify post-translational modifications

  • Purity assessment criteria:

    • 95% purity by densitometric analysis of SDS-PAGE

    • Monodisperse peak on size exclusion chromatography

    • Consistent activity in functional assays

These approaches must be optimized specifically for cemA, considering its hydrophobic nature and structural requirements.

How can CRISPR/Cas9 technology be applied to modify cemA expression in Atropa belladonna for improved photosynthetic efficiency?

CRISPR/Cas9 technology can be strategically applied to modify cemA expression in A. belladonna through several approaches:

  • Targeted gene editing strategy:

    • Design guide RNAs (gRNAs) specific to the cemA gene or its regulatory regions

    • Implement precise modifications using homology-directed repair (HDR) to optimize protein function

    • Create knockout lines to assess the specific contribution of cemA to photosynthetic efficiency

  • Regulatory element engineering:

    • Modify promoter regions to enhance cemA expression levels

    • Engineer 5' and 3' untranslated regions (UTRs) to improve mRNA stability and translation efficiency

    • Create inducible expression systems for experimental manipulation of cemA levels

  • Protocol adaptation from existing A. belladonna CRISPR systems:

    • Utilize Agrobacterium-mediated transformation protocols established for A. belladonna

    • Adapt the CRISPR/Cas9 delivery methods successfully employed for tropane alkaloid pathway engineering in A. belladonna

    • Screen transformants using PCR-based methods similar to those used for AbH6H gene disruption

  • Validation and assessment framework:

    • Measure photosynthetic parameters (CO₂ assimilation rate, quantum yield, electron transport rate)

    • Analyze growth characteristics under varying CO₂ concentrations

    • Evaluate stress tolerance under fluctuating environmental conditions

The successful application of CRISPR/Cas9 for disrupting hyoscyamine 6β-hydroxylase (AbH6H) in A. belladonna demonstrates the feasibility of this approach for other genes in this species . Similar techniques could be adapted for cemA modification, with appropriate adjustments for targeting a chloroplast-encoded gene rather than a nuclear gene.

What analytical techniques are most effective for studying cemA protein-protein interactions within the chloroplast envelope membrane complex?

Studying cemA protein-protein interactions within the chloroplast envelope membrane complex requires specialized analytical techniques that maintain the native membrane environment:

  • In vivo approaches:

    • Förster Resonance Energy Transfer (FRET) using fluorescently tagged proteins

    • Bimolecular Fluorescence Complementation (BiFC) for direct visualization of interactions

    • Split-ubiquitin yeast two-hybrid system adapted for membrane proteins

  • In vitro biochemical methods:

    • Co-immunoprecipitation with specific antibodies against cemA or potential interacting partners

    • Crosslinking mass spectrometry (XL-MS) to identify spatial relationships between proteins

    • Blue Native PAGE to preserve intact membrane protein complexes

    • Surface Plasmon Resonance (SPR) for quantitative interaction analysis

  • Advanced proteomics approaches:

    • Proximity-dependent biotin identification (BioID) to map protein interaction networks

    • Thermal proteome profiling to detect stabilization upon complex formation

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify interaction interfaces

    • Liquid chromatography-tandem mass spectrometry (LC-MS/MS) for comprehensive protein complex identification

  • Computational prediction and validation:

    • Molecular docking simulations to predict potential interaction partners

    • Coevolution analysis to identify correlated mutation patterns suggestive of interactions

    • Network analysis based on existing chloroplast envelope membrane proteome data

These techniques can be integrated into a comprehensive workflow to map the interactome of cemA within the chloroplast envelope membrane complex, providing insights into its functional relationships.

How does the structure-function relationship of cemA contribute to carbon fixation efficiency in Atropa belladonna under varying environmental conditions?

The structure-function relationship of cemA contributes to carbon fixation efficiency in A. belladonna through several mechanisms that can be modulated under varying environmental conditions:

  • Structure-based functional domains:

    • Transmembrane domains: Likely form channels or pores for CO₂ transport

    • Substrate binding regions: Potentially contain specific amino acid residues that facilitate CO₂ recognition

    • Regulatory domains: May interact with other proteins or respond to environmental signals

  • Environmental response mechanisms:

    • Temperature effects: Structural changes in cemA under temperature stress may alter CO₂ transport efficiency

    • Light intensity adaptation: Potential conformational changes in response to varying light conditions

    • CO₂ concentration sensing: Possible allosteric regulation based on substrate availability

  • Integration with carbon fixation pathways:

    • Coordination with Rubisco activity: cemA function may be synchronized with carbon fixation enzymes

    • Metabolic feedback regulation: Products of carbon fixation might modulate cemA activity

    • Energy coupling: Potential dependence on proton gradients or ATP for active transport functions

  • Experimental approaches for structure-function analysis:

    • Site-directed mutagenesis to identify critical residues

    • Chimeric protein construction using domains from cemA homologs from different species

    • Structure determination through X-ray crystallography, cryo-EM, or NMR spectroscopy

    • Functional assays under controlled environmental conditions simulating natural variability

Understanding these relationships would require integration of structural biology, biochemistry, and physiological studies under controlled environmental conditions relevant to A. belladonna's natural habitat.

What quality control procedures should be implemented when producing recombinant cemA protein to ensure experimental reproducibility?

A comprehensive quality control (QC) framework for recombinant cemA protein production should include:

  • Expression system validation:

    • Document cell line/strain authentication

    • Verify plasmid sequence integrity before each expression batch

    • Monitor growth conditions and expression parameters (temperature, inducer concentration, duration)

  • Purification process controls:

    • Implement in-process testing at each purification stage

    • Document yield, purity, and activity metrics for each batch

    • Establish acceptable ranges for critical quality attributes

  • Analytical characterization panel:

    • SDS-PAGE with Coomassie staining for purity assessment

    • Western blot analysis for identity confirmation

    • Liquid chromatography-tandem mass spectrometry (LC-MS/MS) for detailed protein characterization and post-translational modification analysis

    • Circular dichroism for secondary structure verification

    • Size exclusion chromatography for homogeneity evaluation

  • Functional validation assays:

    • Develop and standardize activity assays specific to cemA function

    • Establish reference standards for comparative analysis

    • Document batch-to-batch functional consistency

  • Storage stability monitoring:

    • Test protein integrity after storage under different conditions

    • Establish shelf-life parameters

    • Document freeze-thaw stability

  • Systematic documentation approach:

    • Implement a standardized GeLC-MS2 workflow for comprehensive protein quality assessment

    • Create detailed batch records documenting all production parameters

    • Generate certificates of analysis for each protein batch

This comprehensive QC framework addresses the issues highlighted in research on recombinant protein quality, where varying purity levels and post-translational modifications can lead to inconsistent results in downstream applications .

How can mass spectrometry be utilized to verify the identity and integrity of recombinant cemA protein?

Mass spectrometry offers powerful tools for verifying the identity and integrity of recombinant cemA protein through a multi-faceted analytical approach:

This comprehensive approach provides a robust verification of recombinant cemA identity and integrity, addressing potential issues in protein production that could affect experimental outcomes .

How might comparative studies between cemA from Atropa belladonna and other medicinal plants contribute to understanding specialized chloroplast functions?

Comparative studies of cemA between A. belladonna and other medicinal plants could reveal important insights into specialized chloroplast functions through several research approaches:

  • Evolutionary and functional divergence analysis:

    • Phylogenetic comparison of cemA sequences across medicinal plant species

    • Correlation of sequence variations with specific ecological niches

    • Identification of selection pressures on cemA in different plant lineages

    • Functional complementation studies to test interchangeability between species

  • Structure-function relationship exploration:

    • Comparison of conserved domains versus variable regions

    • Identification of species-specific motifs that might relate to specialized functions

    • Modeling of protein structure based on sequence variations

    • Analysis of interaction interfaces with other chloroplast proteins

  • Integration with secondary metabolism:

    • Investigation of potential links between cemA function and tropane alkaloid biosynthesis in A. belladonna

    • Comparison with cemA function in other alkaloid-producing plants

    • Exploration of CO₂ fixation efficiency as it relates to carbon allocation for specialized metabolites

    • Analysis of cemA regulation in response to environmental factors that also trigger secondary metabolism

  • Methodological approaches:

    • Multi-omics integration (genomics, transcriptomics, proteomics, metabolomics)

    • CRISPR-based gene editing to create chimeric cemA variants

    • Advanced imaging techniques to visualize chloroplast membrane dynamics

    • Isotope labeling studies to track carbon flow from fixation to specialized metabolism

These comparative studies could potentially reveal how variations in cemA contribute to the unique metabolic capabilities of medicinal plants like A. belladonna, particularly in the biosynthesis of pharmacologically active compounds such as tropane alkaloids .

What potential biotechnological applications exist for recombinant cemA protein beyond basic research?

Recombinant cemA protein from A. belladonna offers several promising biotechnological applications beyond basic research:

  • Biosensor development:

    • CO₂ detection systems based on cemA functional properties

    • Environmental monitoring tools for carbon dynamics

    • Diagnostic platforms utilizing cemA-based sensing elements

    • Integration into microfluidic devices for portable applications

  • Biocatalysis and carbon capture:

    • Enhanced carbon fixation systems for bioreactors

    • Incorporation into artificial photosynthetic systems

    • Development of biomimetic membranes for carbon capture

    • Engineering of microorganisms with improved CO₂ utilization

  • Agricultural improvement strategies:

    • Development of transgenic crops with optimized cemA variants

    • Enhancement of photosynthetic efficiency under varying CO₂ conditions

    • Improved crop adaptability to climate change scenarios

    • Creation of plants with enhanced carbon use efficiency

  • Pharmaceutical applications:

    • Potential antimicrobial activities based on membrane-disrupting properties

    • Drug delivery systems utilizing cemA-based membrane carriers

    • Production platforms for bioactive compounds dependent on efficient carbon fixation

    • Development of screening systems for compounds affecting carbon metabolism

  • Synthetic biology approaches:

    • Design of minimal chloroplast systems incorporating cemA

    • Creation of synthetic cell-like entities with carbon-fixing capabilities

    • Engineering of novel protein-protein interactions for expanded functionality

    • Development of orthogonal biological systems with unique properties

These applications could build upon the established methodologies for recombinant protein production and quality control , while leveraging the unique properties of cemA as a mediator of carbon transport in photosynthetic systems.

How might the study of cemA contribute to understanding the evolutionary adaptation of Atropa belladonna to different environmental niches?

The study of cemA can provide valuable insights into the evolutionary adaptation of A. belladonna to different environmental niches through several research dimensions:

  • Molecular evolution perspectives:

    • Analysis of cemA sequence conservation/divergence across A. belladonna populations from different habitats

    • Identification of adaptive mutations correlating with specific environmental conditions

    • Assessment of selection pressures on different domains of the protein

    • Comparison with cemA evolution in related Solanaceae family members

  • Ecophysiological adaptation mechanisms:

    • Characterization of cemA function under varying CO₂ concentrations mimicking different habitats

    • Investigation of temperature effects on cemA activity across the geographical range of A. belladonna

    • Analysis of drought response patterns and their relationship to cemA function

    • Light intensity adaptation studies related to cemA performance

  • Carbon economy relationships:

    • Exploration of how cemA efficiency might influence carbon allocation to tropane alkaloid biosynthesis

    • Investigation of the balance between photosynthetic carbon fixation and specialized metabolism

    • Analysis of how environmental stress modulates the relationship between primary and secondary metabolism

    • Correlation of cemA variants with alkaloid content in different A. belladonna ecotypes

  • Methodological approaches:

    • Population genomics focusing on cemA and related chloroplast genes

    • Reciprocal transplant experiments combined with cemA functional studies

    • Environmental niche modeling integrated with molecular data

    • Experimental evolution under controlled conditions to observe cemA adaptation in real-time

  • Integration with secondary metabolism adaptation:

    • Analysis of how the efficiency of carbon fixation (mediated by cemA) relates to the production of defensive compounds

    • Investigation of potential co-evolution between cemA and genes involved in tropane alkaloid biosynthesis

    • Exploration of how cemA variants might influence the plant's capacity for producing pharmaceutical compounds like hyoscyamine, anisodamine, and scopolamine

This multifaceted approach could reveal how A. belladonna has adapted its carbon acquisition mechanisms to thrive in diverse environments while maintaining its distinctive secondary metabolism profile.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.