Recombinant Atropa belladonna NAD (P)H-quinone oxidoreductase subunit 6, chloroplastic (ndhG)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Mechanism

Role in Photosynthesis

  • Catalyzes electron transfer from NAD(P)H to plastoquinone in chloroplasts, contributing to cyclic electron flow around Photosystem I .

  • Couples redox reactions to proton translocation, aiding in ATP synthesis .

Catalytic Features

  • Cofactors: Requires tightly bound FAD and iron-sulfur clusters .

  • Substrates: NADH or NADPH with equal efficiency .

  • Inhibitors: Dicoumarol acts as a competitive inhibitor .

Biotechnological Applications

Recombinant Production

  • Expression: Optimized in E. coli systems for high-yield production .

  • Purity: Affinity-purified via His-tag, achieving >90% homogeneity .

Research Use Cases

  • Electron Transport Studies: Used to dissect chloroplast respiratory chain mechanisms .

  • Stress Response Models: Investigated for its role in mitigating oxidative stress in plants .

Comparative Analysis with Homologs

SpeciesProtein NameKey Differences
Draba nemorosaNAD(P)H-quinone oxidoreductase subunit 687% sequence similarity to A. belladonna ndhG
Arabidopsis thalianaNdhH (Subunit H)Larger subunit (49 kDa) with distinct iron-sulfur cluster organization

Research Findings

  • Functional Studies: Silencing ndhG in A. belladonna disrupts plastoquinone reduction, impairing photoprotection under high-light conditions .

  • Structural Insights: X-ray crystallography of homologs reveals a conserved quinone-binding pocket critical for electron transfer .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ndhG; NAD(PH-quinone oxidoreductase subunit 6, chloroplastic; NAD(PH dehydrogenase subunit 6; NADH-plastoquinone oxidoreductase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Atropa belladonna (Belladonna) (Deadly nightshade)
Target Names
ndhG
Target Protein Sequence
MDLSEPIHDFLLVFLGSGLILGGLGVVLLPNPIYSAFSLGLVLVCTSLFYILSNSYFVAA AQLLIYVGAINVLIIFAVMFMNGSEYYKDFHLWTVGDGITSMVCISLFISLITTISDTSW YGIIWTTRSNQIIEQDFLSNSQQIGIHLSTDFFLPFELISIILLDALIGAIAVARQ
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) facilitates the transfer of electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic chain and potentially in a chloroplast respiratory chain. In this species, plastoquinone is believed to be the immediate electron acceptor for the enzyme. NDH couples the redox reaction to proton translocation, thereby conserving redox energy in a proton gradient.
Protein Families
Complex I subunit 6 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How is the ndhG gene organized in the Atropa belladonna chloroplast genome?

The ndhG gene in Atropa belladonna is located within the chloroplast genome, which is typical for members of the Solanaceae family. As part of the plant family that includes tomatoes, potatoes, and eggplants , A. belladonna shares conserved chloroplast genome organization patterns. The ndhG gene specifically encodes the NAD(P)H-quinone oxidoreductase subunit 6, which is integrated into the NDH complex. This gene is part of the genetic machinery essential for chloroplast function, participating in the complex assembly process that involves multiple protein factors and subunits interacting in a coordinated manner .

What molecular techniques are commonly used to isolate the ndhG gene from Atropa belladonna?

Isolation of the ndhG gene from Atropa belladonna typically employs a combination of molecular genetic techniques similar to those used in related studies:

  • Tissue Culture and DNA Extraction: Initial cultivation of plant material under sterile conditions, followed by DNA extraction protocols optimized for Solanaceae species .

  • PCR Amplification: Using specific primers designed based on conserved regions of ndhG sequences from related species within Solanaceae.

  • Molecular Marker Analysis: ISSR (Inter-Simple Sequence Repeat) primers can be used for genetic characterization, with polymorphism detection rates of approximately 54-86% depending on the primer used .

  • Sequencing Verification: After amplification, sequencing confirms the identity and integrity of the isolated gene.

For example, studies on A. belladonna have successfully used MS medium supplemented with plant growth regulators for tissue culture, followed by molecular analysis techniques that achieved genetic characterization with polymorphism percentages ranging from 43% to 86% .

How does the structure of recombinant ndhG from Atropa belladonna compare with other species in the Solanaceae family?

The structure of recombinant ndhG from Atropa belladonna shares significant homology with other members of the Solanaceae family, reflecting evolutionary conservation of this important chloroplast protein. Comparative analysis reveals:

SpeciesSequence Similarity to A. belladonna ndhGStructural DistinctionsFunctional Implications
Solanum melongena (Eggplant)High (estimated >80%)Minor variations in connecting loopsPotentially similar functional properties
Solanum nigrumModerate-highDistinguished by different expression patternsMay reflect adaptation to different ecological niches
Other SolanaceaeVariable (70-90%)Species-specific variations in electron transport capacityReflects evolutionary adaptations

These structural comparisons are consistent with the genetic diversity observed in Solanaceae accessions, where studies using molecular markers have found genetic similarity indices ranging from 0.37 to 0.90 . The NDH complex's L-shaped skeleton is highly conserved across these related species, suggesting functional constraints on structural evolution .

What are the mechanisms of assembly for the NDH complex involving ndhG in Atropa belladonna chloroplasts?

The assembly of the NDH complex in Atropa belladonna chloroplasts involves a sophisticated multistep process with ndhG as a critical component. Recent research indicates:

  • Stroma-Localized Assembly Factors: Several stroma-localized factors are required for the assembly of the stroma-protruding arm (subcomplex A) of NDH, which includes ndhG .

  • Sequential Assembly Process: The process appears to follow a coordinated sequence where specific assembly factors such as CHLORORESPIRATORY REDUCTION (CRR) proteins interact with NDH subunits.

  • Identification of Novel Proteins: Research has identified proteins including CRR41 and CRR42 as essential stromal factors involved in this assembly process .

  • Subunit Integration: ndhG integration occurs within a specific window of the assembly sequence, requiring proper folding and association with other subunits to form the functional complex.

This complex assembly mechanism ensures proper electron transport function within the chloroplast, with evidence suggesting that disruption of this process impacts photosynthetic efficiency and plant stress responses.

How do environmental stressors affect the expression and function of ndhG in Atropa belladonna?

Environmental stressors significantly modulate ndhG expression and function in Atropa belladonna, with implications for plant adaptation:

Environmental StressorEffect on ndhG ExpressionFunctional ConsequenceAdaptation Mechanism
Light intensity variationDifferential regulationAltered cyclic electron flowOptimization of photosynthetic efficiency
Drought stressGenerally upregulatedEnhanced chlororespirationProtective mechanism against photodamage
Temperature extremesComplex response patternModified NDH complex assemblyMaintenance of electron transport under stress
Radiation exposureGenetic polymorphism changesAltered secondary metabolite productionPotential link to alkaloid biosynthesis

Research with helium-neon laser radiation on A. belladonna demonstrates that exposure to specific doses (particularly 25 J cm-2) can significantly impact plant growth parameters and secondary metabolite production . This suggests that environmental factors may influence ndhG function by altering gene expression patterns or post-translational modifications, potentially linking chloroplast function to the plant's broader stress response systems.

What are the optimal conditions for recombinant expression of Atropa belladonna ndhG protein?

The optimal conditions for recombinant expression of A. belladonna ndhG protein involve a carefully calibrated protocol:

  • Expression System Selection:

    • Bacterial systems (E. coli BL21(DE3)) with specialized vectors containing chloroplast transit peptide sequences

    • Eukaryotic alternatives (yeast or insect cells) for cases requiring post-translational modifications

  • Expression Optimization Parameters:

ParameterOptimal RangeCritical Considerations
Temperature16-22°CLower temperatures reduce inclusion body formation
Induction0.1-0.5 mM IPTGGentle induction improves soluble protein yield
Expression Duration16-24 hoursExtended time at lower temperatures enhances folding
Media CompositionSupplemented minimal mediaAddition of specific cofactors improves yield
  • Solubilization Strategy:

    • Inclusion of mild detergents (0.5-1% Triton X-100)

    • Careful titration of imidazole concentrations (20-40 mM) during purification to maintain protein stability

These recommendations derive from protocols used in related studies of chloroplast proteins and acknowledge the challenging nature of expressing membrane-associated chloroplast proteins in recombinant systems.

What purification methods yield the highest purity and activity for recombinant ndhG protein?

A multi-step purification strategy is recommended to achieve optimal purity and activity for recombinant ndhG protein:

  • Initial Capture:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA or Co-NTA resins with His-tagged constructs

    • Careful buffer optimization to include glycerol (10-15%) and reducing agents (1-5 mM DTT or 2-ME)

  • Intermediate Purification:

    • Ion exchange chromatography (typically DEAE or Q-Sepharose) to separate based on charge characteristics

    • Size exclusion chromatography to remove aggregates and isolate properly folded protein

  • Polishing and Activity Preservation:

Purification StepKey ParametersQuality Assessment
Detergent ExchangeTransition to milder detergents (0.02-0.05% DDM)Spectroscopic integrity check
Buffer OptimizationpH 7.2-7.8, 100-150 mM NaClActivity assays after each step
Stability EnhancementAddition of 5-10% glycerol and 1 mM EDTALong-term storage stability testing
Final ConcentrationControlled concentration below aggregation thresholdDynamic light scattering analysis
  • Activity Verification:

    • Spectrophotometric assays measuring NAD(P)H oxidation rates

    • Electron transport measurements in reconstituted systems

This purification workflow addresses the challenges associated with maintaining the native-like structure of chloroplast proteins while removing contaminants that could interfere with subsequent biochemical and structural analyses.

What techniques are most effective for analyzing ndhG interaction with other subunits of the NDH complex?

Multiple complementary techniques provide comprehensive insights into ndhG interactions within the NDH complex:

  • Co-Immunoprecipitation (Co-IP):

    • Using antibodies against ndhG or epitope tags to pull down interaction partners

    • Analysis by mass spectrometry to identify associated proteins

    • Quantitative analysis of interaction stoichiometry

  • Crosslinking Mass Spectrometry:

    • Chemical crosslinking with MS-compatible reagents (BS3, DSS, or EDC)

    • Identification of proximity relationships through crosslinked peptide analysis

    • Determination of interaction interfaces at amino acid resolution

  • Functional Reconstitution:

ApproachInformation GainedTechnical Considerations
Liposome ReconstitutionActivity in membrane environmentLipid composition optimization
Electron Transport AssaysFunctional coupling with other componentsRequires intact electron transport chain
Mutagenesis StudiesCritical residues for interactionsValidation through multiple approaches
  • Advanced Biophysical Methods:

    • Surface plasmon resonance (SPR) for binding kinetics

    • Fluorescence resonance energy transfer (FRET) for real-time interaction dynamics

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) for conformational analysis

These methods have been adapted from approaches used to study the assembly of stroma-protruding arms of NDH complexes, where protein-protein interactions are critical for proper function .

How should researchers interpret changes in ndhG expression levels in response to experimental treatments in Atropa belladonna?

Researchers should employ a systematic framework for interpreting ndhG expression changes:

Expression ChangePotential InterpretationValidation Approach
>2-fold increaseSignificant upregulation, likely physiological responseProtein-level confirmation, functional assays
1.5-2-fold changeModerate regulation, may indicate adjustmentTemporal analysis, dose-response studies
<1.5-fold changeSubtle modulation, potential fine-tuningStatistical rigor, biological replicates
Tissue-specific variationsSpecialized adaptation to local conditionsIn situ hybridization, tissue-specific proteomics
  • Integration with Physiological Data:

    • Correlate expression changes with photosynthetic parameters

    • Assess impact on secondary metabolite production, particularly tropane alkaloids

    • Consider whole-plant physiological responses

What statistical approaches are most appropriate for analyzing experimental data related to ndhG function?

Robust statistical approaches for ndhG functional data analysis include:

  • Experimental Design Considerations:

    • Power analysis to determine appropriate sample sizes

    • Factorial designs to assess interaction effects

    • Blocked designs to control for environmental variables

  • Statistical Testing Framework:

Data TypeRecommended AnalysisAssumptions and Validations
Gene ExpressionANOVA with post-hoc tests (Tukey HSD)Data normality, equal variance
Protein-Protein InteractionsRegression analysis, correlation coefficientsLinearity, independence of observations
Functional AssaysMixed-effects models, repeated measures ANOVASphericity, compound symmetry
Genetic VariationMultivariate analysis (PCA, clustering)Sampling adequacy, appropriate distance metrics
  • Advanced Statistical Approaches:

    • Bayesian inference for complex datasets with prior knowledge

    • Machine learning for pattern recognition in multi-parameter data

    • Meta-analysis when combining results across multiple studies

Studies on genetic relationships in A. belladonna have employed dendrogram analysis to understand relationships between treatments, where cluster analysis revealed distinct groupings based on genetic similarities ranging from approximately 75% to 100% . Similar approaches can be valuable when analyzing ndhG functional data in the context of genetic variations or treatment effects.

How can researchers address inconsistent results between different analytical methods when studying ndhG?

Researchers can systematically address inconsistencies through a structured approach:

  • Method-Specific Considerations:

    • Evaluate inherent limitations of each analytical technique

    • Assess sensitivity, specificity, and dynamic range differences

    • Consider fundamental differences in what each method measures

  • Reconciliation Strategy:

Inconsistency TypeReconciliation ApproachImplementation Example
Expression level discrepanciesMulti-method validationCombine qPCR, RNA-seq, and protein quantification
Functional activity variationsStandardize assay conditionsUnified buffer systems, consistent temperature control
Interaction partner differencesOrthogonal confirmationValidate key interactions with multiple methods
Genetic polymorphism inconsistenciesPopulation-level analysisAssess broader genetic context and population structure
  • Integrated Analysis Framework:

    • Develop weightings based on methodological confidence

    • Implement Bayesian integration of multiple data sources

    • Consider hierarchical models that account for method-specific biases

When studying ndhG in A. belladonna, researchers might encounter inconsistencies between molecular genetic data (such as ISSR analysis with polymorphism rates of 43-86%) and functional biochemical assays. Resolution requires understanding how genetic variations translate to functional differences, potentially through intermediate analyses of transcript and protein levels.

What are common problems in recombinant expression of ndhG and how can they be resolved?

Researchers commonly encounter several challenges when expressing recombinant ndhG:

  • Poor Expression Yield:

    • Problem: Low protein production despite optimized vectors

    • Solution: Codon optimization specific to expression host; use of specialized strains (Rosetta, Arctic Express); testing different fusion tags (MBP, SUMO)

  • Protein Insolubility:

ProblemResolution StrategySuccess Indicators
Inclusion body formationExpression at lower temperatures (16°C); co-expression with molecular chaperones>30% protein in soluble fraction
Aggregation during purificationAddition of stabilizing agents (glycerol, specific lipids); optimization of detergent type and concentrationMonodisperse peak on size exclusion chromatography
Loss of cofactorsSupplementation with specific cofactors during expression and purificationCharacteristic spectral properties maintained
  • Poor Protein Stability:

    • Problem: Rapid degradation during purification or storage

    • Solution: Addition of protease inhibitors; screening stabilizing buffer conditions; storage in flash-frozen aliquots

  • Lack of Functional Activity:

    • Problem: Purified protein lacks expected enzymatic activity

    • Solution: Co-expression with interaction partners; reconstitution with lipids; addition of specific cofactors

These approaches are particularly relevant for chloroplast proteins like ndhG, which normally exist in a membrane environment and as part of larger complexes like the NDH complex .

How can researchers overcome challenges in studying the interaction between ndhG and other NDH complex subunits?

Overcoming interaction study challenges requires strategic approaches:

  • Complex Stability Issues:

    • Challenge: Transient or weak interactions lost during analysis

    • Solution: Chemical crosslinking; optimized buffer conditions; rapid analysis techniques

  • Reconstitution Difficulties:

ChallengeStrategic ApproachTechnical Implementation
Incomplete complex assemblyStepwise reconstitutionSequential addition of purified components in controlled ratios
Non-physiological interactionsNative expression systemsUse of chloroplast isolation from transgenic plants expressing tagged subunits
Loss of accessory factorsComplex isolation from sourceGentle purification methods preserving intact complexes
  • Functional Validation Hurdles:

    • Challenge: Confirming biological relevance of observed interactions

    • Solution: In vivo validation through complementation studies; correlation with photosynthetic phenotypes; site-directed mutagenesis of interaction interfaces

  • Stoichiometry Determination:

    • Challenge: Establishing correct subunit ratios in the assembled complex

    • Solution: Absolute quantification methods; native mass spectrometry; single-molecule approaches

Studies on NDH complex assembly have identified several assembly factors like CRR1, CRR6, CRR7, CRR41, and CRR42 that facilitate proper integration of subunits . Understanding these assembly pathways provides insight into the challenges of reconstituting functional interactions in experimental systems.

What strategies can address genetic variability in Atropa belladonna that affects ndhG studies?

Genetic variability in A. belladonna requires targeted management strategies:

  • Source Material Standardization:

    • Development of reference genetic lines

    • Detailed characterization of source material using molecular markers

    • Establishment of tissue culture systems for consistent propagation

  • Genetic Characterization Approaches:

ApproachApplicationImplementation Details
Molecular Marker ProfilingGenetic background verificationUse of ISSR markers with established polymorphism rates (43-86%)
Targeted SequencingndhG allele identificationDirect sequencing of the gene and regulatory regions
Genome-Wide AnalysisContextual genetic environmentAssessment of chloroplast genome variations affecting ndhG function
  • Experimental Design Considerations:

    • Use of biological and technical replicates to account for variability

    • Implementation of blocked experimental designs grouping similar genetic backgrounds

    • Statistical approaches that incorporate genetic background as a variable

  • Data Interpretation Framework:

    • Development of genotype-specific baselines for comparative analyses

    • Correlation analysis between genetic variations and functional parameters

    • Meta-analysis approaches for integrating results across genetic backgrounds

Research on A. belladonna has demonstrated genetic diversity can be effectively characterized using molecular techniques, with dendrogram analysis showing genetic relationships between different treatments with similarity indices ranging from approximately 75% to 100% . Similar approaches can help researchers categorize and account for genetic variability in ndhG studies.

What are promising research avenues for understanding the role of ndhG in photosynthetic efficiency under changing climatic conditions?

Several high-potential research directions emerge for investigating ndhG's role in photosynthetic adaptation:

  • Climate Change Response Mechanisms:

    • Investigation of ndhG expression and NDH complex function under elevated CO₂

    • Analysis of temperature response thresholds in different A. belladonna ecotypes

    • Assessment of drought-responsive regulation of cyclic electron flow

  • Integrative Research Approaches:

Research DirectionMethodological ApproachExpected Insights
Comparative GenomicsMulti-species analysis of ndhG evolutionIdentification of adaptive signatures in sequence
Systems BiologyIntegration of transcriptomics, proteomics, and metabolomicsComprehensive understanding of regulatory networks
Synthetic BiologyEngineering modified ndhG variantsStructure-function relationships and optimization potential
  • Translational Applications:

    • Development of stress-resistant variants through targeted ndhG modification

    • Application of knowledge to related Solanaceae crops (tomato, potato, eggplant)

    • Exploration of connections between photosynthetic efficiency and alkaloid production

  • Technological Innovations:

    • Development of high-throughput phenotyping for NDH complex function

    • Application of cryo-EM for structural analysis of the intact complex

    • Implementation of optogenetic approaches to control ndhG function

These research directions build upon known connections between environmental factors and plant physiology in A. belladonna, where treatments such as laser irradiation have been shown to significantly affect growth parameters and secondary metabolite production .

How might advanced genetic techniques enhance our understanding of ndhG function in Atropa belladonna?

Advanced genetic techniques offer transformative potential for ndhG research:

  • CRISPR/Cas9 Genome Editing:

    • Generation of precise ndhG mutations or knockouts

    • Creation of tagged versions for in vivo localization and interaction studies

    • Development of conditional expression systems

  • Next-Generation Approaches:

TechniqueApplication to ndhG ResearchTechnical Considerations
Single-Cell OmicsCell-specific expression patterns within different leaf tissuesRequires specialized tissue preparation
Long-Read SequencingComplete chloroplast genome assembly and structural variant identificationImportant for accurate genetic context
Epigenetic AnalysisAssessment of regulatory mechanisms affecting ndhG expressionMay reveal environmental response mechanisms
  • Synthetic Biology Strategies:

    • Designer NDH complexes with modified subunit composition

    • Orthogonal expression systems for functional testing

    • Domain swapping experiments to determine functional regions

  • Multi-Omics Integration:

    • Correlation of genotype with transcriptome, proteome, and metabolome

    • Network analysis to position ndhG in broader regulatory frameworks

    • Identification of unexpected connections to secondary metabolism

These advanced approaches build upon existing molecular genetic techniques used in A. belladonna research, where methods like ISSR analysis have already demonstrated utility in characterizing genetic relationships with polymorphism rates of 43-86% . Next-generation approaches promise even deeper insights into ndhG function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.