Recombinant Atropa belladonna Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Definition and Functional Role

CP47 is a core chlorophyll-binding antenna protein in PSII, facilitating light energy transfer to the reaction center. The recombinant variant retains the native structure and function of the wild-type protein, with sequences expressed heterologously in systems like E. coli for research applications . Key roles include:

  • Light Harvesting: Binds 14–16 chlorophyll a molecules and β-carotene to capture photons .

  • PSII Stabilization: Anchors the D1/D2 reaction center proteins and supports oxygen-evolving complex assembly .

  • Chlorophyll Biosynthesis Regulation: Interacts with auxiliary proteins like Psb28 to ensure proper chlorophyll and apoprotein synthesis .

Primary Structure

The psbB-encoded CP47 protein from A. belladonna comprises 508 amino acids (56 kDa) with a conserved transmembrane domain structure . Key features include:

FeatureDetail
Molecular Weight56 kDa (predicted from sequence)
Transmembrane Helices6 α-helices, forming chlorophyll-binding pockets
His TagsN-terminal His tag in recombinant forms for purification

Chlorophyll-Binding Sites

  • Histidine Ligands: Five conserved histidine residues coordinate chlorophyll Mg²⁺ ions .

  • Pigment Organization: Chlorophylls are arranged in two concentric rings around the reaction center, optimizing energy transfer .

Biogenesis and Assembly

CP47 integrates early into PSII assembly intermediates (e.g., RC47 complexes) and requires chaperones like Psb28 for stability :

  • Psb28 Dependency: In Synechocystis mutants lacking Psb28, CP47 synthesis declines by 50%, and chlorophyll biosynthesis stalls at protochlorophyllide .

  • Co-Purified Partners: PsbH, PsbL, and PsbT associate with CP47 during assembly .

Assembly Defects in Mutants

MutantPhenotype
ΔPsb28Reduced CP47 accumulation, impaired PSII repair
ΔCP43/ΔPsb28Near-complete loss of unassembled CP47

Expression Systems

  • Host: E. coli (common for high-yield production) .

  • Purification: Nickel-affinity chromatography via His tags .

Applications in Research

  • PSII Biogenesis Studies: Used to dissect assembly pathways and interactions with Psb28/Ycf12 .

  • Chlorophyll-Protein Dynamics: Fluorescence and absorption spectroscopy reveal energy transfer mechanisms .

  • Drug Discovery: A. belladonna recombinant proteins aid in studying tropane alkaloid biosynthesis , though CP47 itself is not directly involved in alkaloid production.

Comparative Analysis

The A. belladonna CP47 shares 85% sequence identity with Draba nemorosa CP47 but differs in chlorophyll-binding regions (e.g., residues 210–240) . Such variations may influence pigment-protein interactions across species.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate special requests for the format. Please specify your preferred format during the order placement and we will fulfill your requirement.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Atropa belladonna (Belladonna) (Deadly nightshade)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSITGGTVTNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTKRQAA
Uniprot No.

Target Background

Function
CP47, a crucial component of the Photosystem II (PSII) core complex, plays a vital role in the primary light-induced photochemical processes of PSII. It binds chlorophyll and facilitates the catalytic reactions within PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from water, producing oxygen (O2) and a proton gradient, which subsequently drives ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the psbB gene and what protein does it encode?

The psbB gene encodes the CP47 protein (also known as CP47 chlorophyll apoprotein), which is an essential component of Photosystem II (PSII). This protein has been hypothesized to be involved in binding the reaction center chlorophyll within the photosynthetic apparatus. The CP47 protein functions as an inner antenna subunit that facilitates light harvesting and energy transfer within PSII .

How conserved is the psbB gene across species?

Research has demonstrated significant conservation of the psbB gene across photosynthetic organisms. When comparing the psbB gene from cyanobacteria (Synechocystis 6803) and higher plants (spinach), DNA sequence homology reaches approximately 68%, while the predicted amino acid sequence shows even higher conservation at 76% homology . This high degree of conservation suggests the critical evolutionary importance of the CP47 protein's function in photosynthesis.

What is the membrane topology of the CP47 protein?

The CP47 protein exhibits nearly identical hydropathy patterns between cyanobacteria and higher plants like spinach, indicating a conserved folding pattern within the thylakoid membrane across species. Structural analysis has identified five pairs of histidine residues in CP47 that are spaced by 13 or 14 amino acids and located in hydrophobic regions of the protein. These histidine residues are proposed to be involved in chlorophyll binding, contributing to the protein's function in light harvesting .

What techniques are used to study the excitonic structure of CP47?

Researchers employ multiple spectroscopic methods to investigate the excitonic structure of CP47, including:

These techniques, when used in combination, provide complementary data that allows researchers to develop comprehensive models of the protein's excitonic structure .

How can researchers isolate and purify CP47-containing complexes?

The isolation of CP47-containing complexes typically involves a multi-step purification process:

  • Preparation of thylakoid membranes from plant or cyanobacterial sources

  • Solubilization of membrane proteins using mild detergents

  • Initial separation using clear native gel electrophoresis

  • Further purification via glycerol gradient ultracentrifugation

  • Concentration of the isolated complex

For enhanced purification and detection, researchers often use strains with histidine-tagged CP47 (His-CP47), which facilitates isolation of specific CP47-containing subcomplexes. The purity of isolated complexes can be verified through various techniques, including SDS-PAGE, immunoblotting, and mass spectrometry .

What analytical methods are used to characterize the protein composition of CP47 complexes?

Researchers employ multiple complementary techniques to fully characterize CP47 complexes:

  • SDS-PAGE: Separates proteins based on molecular weight to identify major components

  • Immunoblotting: Confirms the presence of specific proteins using antibodies against CP47, PsbH, and other PSII subunits

  • Tandem mass spectrometry (MS/MS): Provides comprehensive protein identification after in-solution or in-gel digestion

  • Intact protein mass spectrometry: Determines the exact mass of low molecular mass (LMM) subunits associated with CP47

  • Clear native gel electrophoresis: Assesses the integrity and size of the native complex

How can the CP47 protein be recombinantly produced in plant expression systems?

Recombinant expression of CP47 in plant systems, particularly Atropa belladonna, typically involves plastid transformation techniques. The process includes:

  • Design of expression constructs containing the psbB gene with appropriate regulatory elements

  • Selection of optimal 5'-UTR and 3'-UTR sequences (traditionally psbA/TpsbA UTRs are common choices)

  • Transformation of plant plastids using biolistic delivery methods

  • Selection of transformants on antibiotic-containing media

  • Confirmation of homoplasmic state through multiple rounds of selection

  • Analysis of recombinant protein expression levels

Research indicates that while psbA/TpsbA UTRs are traditionally used, the highest levels of recombinant protein expression can be achieved using atpA or psbD 5'-UTRs. The choice of 3'-UTR generally has less impact on protein accumulation .

What strategies can enhance recombinant CP47 expression in chloroplasts?

Several approaches have been developed to optimize recombinant protein expression in chloroplasts:

StrategyMechanismPotential Impact on CP47 Expression
Light regulationUsing psbA 5'-UTR to confer light-regulated translationAllows for controlled expression of potentially toxic proteins
Deletion of endogenous geneRemoving competing endogenous psbAReduces competition for transcription/translation factors
Optimization of ribosome binding sitesDesigning prokaryotic RBSs for desired translation ratesEnhances translation initiation efficiency
Fusion to native proteinsFusing recombinant products to endogenous proteins (e.g., Rubisco LSU)Can increase protein yield up to 33-fold
Codon optimizationAdapting coding sequence to chloroplast codon usageImproves translation efficiency

These strategies can be applied individually or in combination to achieve optimal expression levels of recombinant CP47 .

What is the role of CP47 in novel chlorophyll protein complexes associated with PSII repair?

Recent research has identified a novel chlorophyll protein complex containing CP43 and CP47 that appears to play a role in the PSII repair cycle. This complex, sometimes referred to as the NRC complex, lacks or has significantly reduced levels of the D1, D2, and PsbE proteins that are normally part of the PSII reaction center.

Analysis of this complex by mass spectrometry reveals:

  • Dominant presence of CP47 and CP43 inner antenna subunits

  • Markedly decreased levels of D1, D2, PsbE, and PsbF compared to standard PSII monomers

  • Presence of the CP47-associated low molecular mass subunit PsbH

  • Only 7 of the 10 low molecular mass subunits found in intact PSII monomers

This complex may represent an intermediate stage in the PSII repair cycle, potentially involved in protecting chlorophyll molecules during the replacement of damaged D1 protein .

What are the current challenges in understanding the excitonic structure of CP47?

Despite extensive research, several challenges remain in fully understanding the excitonic structure of CP47:

  • Lack of consensus on chlorophyll site energies: Different modeling studies of various types of CP47 optical spectra have yielded inconsistent estimations of chlorophyll site energies

  • Sample heterogeneity: Studies have revealed the heterogeneous nature of CP47 complexes, complicating spectroscopic analysis

  • Composite nature of circularly polarized luminescence (CPL): The CPL signal often represents contributions from multiple components (CPL 685, CPL 691, and CPL 695) rather than intact CP47 protein

  • Difficulties in identifying lowest energy pigments: The exact identity of the lowest energy pigments remains debated, despite their importance for understanding excitation energy pathways

How might CP47 research contribute to improving photosynthetic efficiency?

Understanding the structure and function of CP47 has significant implications for enhancing photosynthetic efficiency through several potential research directions:

  • Engineering optimized energy transfer pathways by manipulating chlorophyll binding sites

  • Designing more efficient light-harvesting systems based on CP47's natural architecture

  • Improving PSII repair mechanisms to enhance stress tolerance

  • Developing synthetic photosystems with improved quantum efficiency

  • Creating chimeric photosynthetic complexes that incorporate beneficial features from diverse organisms

Such applications could contribute to agricultural improvements and potentially to artificial photosynthesis technologies for sustainable energy production.

What approaches show promise for resolving the contradictory findings in CP47 excitonic structure research?

To address contradictions in the literature regarding CP47's excitonic structure, researchers are pursuing several promising approaches:

  • Simultaneous fitting of multiple spectroscopic datasets (absorption, emission, CPL, circular dichroism, and hole-burned spectra) to provide more robust constraints on structural models

  • Improved isolation techniques to obtain more homogeneous CP47 samples

  • Advanced spectroscopic methods with higher resolution and sensitivity

  • Integration of structural data from cryo-electron microscopy with spectroscopic findings

  • Development of more sophisticated computational models that account for the protein environment's effects on chlorophyll properties

These approaches may help establish a consensus model of CP47's excitonic structure, resolving current contradictions in the literature .

How does research on CP47 in Atropa belladonna relate to other aspects of this plant's biology?

Atropa belladonna (deadly nightshade) is primarily known for producing pharmaceutical tropane alkaloids (TAs), but research on its photosynthetic machinery, including CP47, provides opportunities to integrate photosynthesis and secondary metabolite research. Studies on transgenic A. belladonna have demonstrated that:

  • Overexpression of key enzymes like putrescine N-methyltransferase (PMT) and hyoscyamine 6β-hydroxylase (H6H) can create scopolamine-rich phenotypes

  • Gene expression patterns of endogenous TA biosynthetic genes (AbPMT, AbTRI, AbCYP80F1, and AbH6H) are highest in secondary roots

  • Higher efficiency of hyoscyamine conversion occurs in aerial parts compared to underground parts

  • Transgenic lines can produce scopolamine at very high levels (2.94-5.13 mg/g) under field conditions

Understanding the photosynthetic capacity and efficiency through CP47 research may help explain energy allocation between primary and secondary metabolism in this medicinally important plant .

What implications does CP47 research have for chloroplast genetic engineering more broadly?

Research on CP47 and the psbB gene provides valuable insights for chloroplast genetic engineering strategies:

  • The stable integration and expression of foreign genes in the chloroplast genome

  • Optimization of regulatory elements for high-level protein expression

  • Understanding of protein assembly pathways in the thylakoid membrane

  • Identification of essential and non-essential regions of chloroplast proteins for function

  • Development of selection markers and reporter systems for plastid transformation

Plastid genetic engineering offers several advantages, including high-level transgenic expression, transgenic containment via maternal inheritance, and the absence of epigenetic effects that can silence nuclear transgenes .

What controls should be included when studying recombinant CP47 protein function?

When investigating recombinant CP47 protein function, researchers should incorporate several critical controls:

  • Wild-type A. belladonna samples to establish baseline expression and function

  • Transformants with empty vectors to account for transformation effects

  • Constructs with mutated versions of psbB to identify essential amino acid residues

  • Heterologous expression in model organisms (e.g., cyanobacteria) for comparative analysis

  • Temporal controls to account for developmental and environmental variation

  • Tissue-specific analyses to determine expression patterns across different plant tissues

How can researchers verify the integrity and functionality of recombinant CP47?

Verification of recombinant CP47 integrity and functionality involves multiple complementary approaches:

Analytical ApproachInformation ProvidedMethodological Considerations
Immunoblot analysisProtein expression level and molecular weightRequires CP47-specific antibodies
Spectroscopic characterizationPigment binding and excitonic propertiesNeeds careful isolation to maintain native state
Chlorophyll fluorescenceEnergy transfer efficiencyShould be measured in intact systems
Oxygen evolution measurementsPSII electron transport functionalityRequires intact thylakoid preparations
Protein-protein interaction studiesAssembly with other PSII componentsCan use co-immunoprecipitation or yeast two-hybrid
Electron microscopyStructural integration into PSII complexesRequires specialized sample preparation

These techniques collectively provide a comprehensive assessment of whether the recombinant CP47 is properly folded, capable of pigment binding, and functionally integrated into photosynthetic complexes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.