Recombinant Atropa belladonna Photosystem II D2 protein (psbD)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

The Recombinant Atropa belladonna Photosystem II D2 protein (psbD) is a genetically engineered variant of the D2 subunit of Photosystem II (PSII), a critical complex in the photosynthetic electron transport chain. This protein, encoded by the chloroplast psbD gene, forms a heterodimer with the D1 protein (psbA) to create the PSII reaction center, which facilitates water oxidation and plastoquinone reduction . Recombinant production enables large-scale study of its structural and functional roles in photosynthesis .

Primary Structure

  • Amino Acid Sequence: Comprises 353 residues (UniProt ID: Q8S8X8), with a conserved N-terminal His-tag for purification .

  • Key Domains:

    • Transmembrane helices for membrane integration .

    • D-de loop region influencing herbicide binding and QB plastoquinone stability .

Expression Systems

PropertyDetails
HostEscherichia coli (E. coli)
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
StorageLyophilized in Tris/PBS buffer with 6% trehalose or 10% glycerol

Assembly in PSII

  • The D2 protein co-translationally integrates into thylakoid membranes, forming a subcomplex with cytochrome b559 before associating with D1 to create the reaction center .

  • In vascular plants, psbD transcription and translation are not rate-limiting for PSII biogenesis, unlike in cyanobacteria or algae .

Functional Insights

  • Electron Transport: Stabilizes the QB-binding niche, critical for plastoquinone-mediated electron transfer .

  • Herbicide Interaction: Modifications in the D-de loop alter herbicide binding efficiency, highlighting its role in pesticide resistance studies .

Experimental Uses

  • Structural Studies: Used to map PSII assembly intermediates and cofactor binding sites .

  • Herbicide Resistance Screening: Mutagenesis of the D-de loop identifies residues affecting herbicide affinity .

  • Quantitative Standards: Recombinant psbD serves as a Western blot control for PSII quantification .

Biotechnological Relevance

  • Photosynthesis Engineering: Facilitates studies on PSII repair mechanisms under stress .

  • Agricultural Innovation: Guides development of herbicide-resistant crops via targeted psbD modifications .

Mutational Analysis

  • Transcription Knockdown: Tobacco mutants with reduced psbD expression fail to survive under autotrophic conditions, underscoring its essential role .

  • Thermoluminescence Shifts: Mutations in the D-de loop alter charge recombination dynamics, affecting QB stability .

Comparative Biology

OrganismpsbD RegulationPSII Assembly Limitation
Synechocystis (Cyanobacteria)Controlled by cyt b559 stabilityYes
Chlamydomonas reinhardtii (Algae)Translation-dependentYes
Nicotiana tabacum (Tobacco)Transcription-independentNo

Data synthesized from Scharff et al. (2017) and Komenda et al. (2004) .

Future Directions

  • Cryo-EM Studies: Resolve psbD’s role in PSII supercomplex organization .

  • CRISPR Applications: Engineer A. belladonna lines with modified psbD to study alkaloid biosynthesis cross-talk .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will do our best to fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timeframes, please consult your local distributor.
Note: All protein orders are shipped with standard blue ice packs. If you require dry ice shipment, please contact us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing should be avoided. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Repeated freeze-thaw cycles should be minimized.
Tag Info
Tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
psbD; Photosystem II D2 protein; PSII D2 protein; Photosystem Q(A protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Atropa belladonna (Belladonna) (Deadly nightshade)
Target Names
psbD
Target Protein Sequence
MTIALDKFTKDENDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFAVGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGA FGLIGFMLRQFELARSVQLRPYNAIAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex that captures photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several subsequent electron acceptors. D2 is essential for the assembly of a stable PSII complex.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Atropa belladonna Photosystem II D2 protein (psbD) and what is its significance in research?

    Atropa belladonna Photosystem II D2 protein (psbD) is a critical component of the photosynthetic apparatus found in the deadly nightshade plant (Atropa belladonna), which belongs to the Solanaceae family. The protein functions as an integral part of Photosystem II, playing a crucial role in the light-dependent reactions of photosynthesis. The recombinant form of this protein is particularly valuable for photosynthesis research, structural biology studies, and comparative analyses of photosynthetic mechanisms across species. As a full-length protein (1-353 amino acids), it contains domains essential for electron transport and photosynthetic function, making it a significant target for understanding fundamental photosynthetic processes .

  • How is Recombinant Atropa belladonna psbD protein typically expressed and purified for research applications?

    Recombinant Atropa belladonna psbD protein is typically expressed in Escherichia coli expression systems using standard molecular cloning techniques. The procedure involves:

    • Cloning the psbD gene from Atropa belladonna into an appropriate expression vector

    • Adding an N-terminal His-tag to facilitate purification

    • Transforming E. coli cells with the recombinant plasmid

    • Inducing protein expression under optimized conditions

    • Lysing cells and purifying the protein using affinity chromatography (Ni-NTA columns)

    • Further purification using size exclusion or ion-exchange chromatography

    • Quality control through SDS-PAGE analysis, confirming >90% purity

    The purified protein is typically supplied in a lyophilized form in Tris/PBS-based buffer with 6% trehalose at pH 8.0, which enhances stability during storage .

  • What are the optimal storage and handling conditions for recombinant psbD protein?

    For optimal stability and functionality of recombinant Atropa belladonna psbD protein, researchers should follow these evidence-based storage and handling protocols:

    Storage ConditionRecommendationNotes
    Long-term storage-20°C to -80°CAliquoting necessary to prevent freeze-thaw damage
    Working aliquots4°CViable for up to one week
    ReconstitutionDeionized sterile waterConcentration: 0.1-1.0 mg/mL
    StabilizerAdd glycerol (5-50% final)50% is recommended for optimal stability
    AvoidRepeated freeze-thaw cyclesCauses protein denaturation and loss of activity

    Following reconstitution, the protein should be gently mixed, not vortexed, to prevent shearing forces that could disrupt protein structure. Centrifuging the vial briefly before opening is recommended to bring contents to the bottom .

  • What methods are used to verify the quality and functionality of recombinant psbD protein?

    Quality control and functional verification of recombinant Atropa belladonna psbD protein typically include:

    1. Purity assessment: SDS-PAGE analysis confirming >90% purity

    2. Western blot: Using anti-His tag antibodies to verify protein identity

    3. Mass spectrometry: For accurate molecular weight confirmation

    4. Circular dichroism spectroscopy: To assess secondary structure integrity

    5. Functional assays:

      • Electron transport measurements

      • Binding assays with known interaction partners

      • Reconstitution experiments in liposomes

    Researchers should document baseline measurements upon receiving the protein to enable comparison over time and across different batches to ensure experimental reproducibility .

Advanced Research Questions

  • How does the plastid genome organization of Atropa belladonna influence the expression and characteristics of psbD?

    Atropa belladonna's plastid genome organization has several distinct features that influence psbD expression:

    1. The psbD gene is located in the Large Single Copy (LSC) region of the chloroplast genome

    2. It is often co-transcribed with psbC from a shared promoter region in many plants

    3. The gene contains RNA editing sites that can alter the amino acid sequence post-transcriptionally

    Understanding this genomic context is crucial for researchers attempting to express functional recombinant protein. While the complete plastid chromosome information for Atropa belladonna is mentioned in the literature, detailed comparative analyses with other Solanaceae members reveal evolutionary conservation patterns that affect protein functionality .

    The photosynthetic apparatus shows high conservation across the Solanaceae family, but species-specific variations in the psbD gene can lead to functional differences that may influence photosynthetic efficiency under different environmental conditions. These variations represent important targets for comparative photosynthesis research.

  • What experimental approaches are optimal for investigating structure-function relationships in recombinant psbD protein?

    Advanced structure-function investigations of recombinant Atropa belladonna psbD protein benefit from multiple complementary approaches:

    TechniqueApplicationResearch Output
    Site-directed mutagenesisModify specific amino acid residuesIdentify functionally critical residues
    Hydrogen-deuterium exchange MSMap solvent-accessible regionsDetermine protein dynamics and interactions
    Cryo-electron microscopyHigh-resolution structural analysisVisualize protein in near-native state
    FRET analysisMeasure distances between domainsDetermine conformational changes
    Reconstitution assaysIntegrate protein into liposomesAssess functional activity in membrane
    Molecular dynamics simulationsComputational structure predictionInvestigate conformational states

    These approaches should be combined with bioinformatic analyses comparing psbD sequences across species to identify conserved functional domains versus species-specific regions that may confer unique properties to the Atropa belladonna protein .

  • How does the recombinant psbD protein interact with other photosystem components, and what methodologies best capture these interactions?

    The psbD protein forms critical interactions with multiple protein partners and cofactors in the functional photosystem. These interactions can be studied using:

    1. Co-immunoprecipitation: Using anti-His tag antibodies to pull down psbD and identify interacting partners

    2. Cross-linking coupled with mass spectrometry: To map interaction interfaces at amino acid resolution

    3. Surface plasmon resonance (SPR): To measure binding kinetics with purified interaction partners

    4. Isothermal titration calorimetry (ITC): For thermodynamic analysis of protein-protein interactions

    5. Native gel electrophoresis: To visualize intact protein complexes

    Key interactions to investigate include:

    • D1 protein (psbA gene product) - forms heterodimeric core with D2

    • Cytochrome b559 subunits

    • CP43 and CP47 antenna proteins

    • Various small subunits that stabilize the PSII complex

    Understanding these interactions is crucial for reconstructing functional photosynthetic complexes in vitro and for interpreting how structural changes impact photosynthetic efficiency .

  • What are the challenges in comparing photosynthetic efficiency between different Atropa belladonna variants using recombinant psbD proteins?

    Comparative analysis of photosynthetic efficiency across Atropa belladonna variants presents several methodological challenges:

    1. Variant-specific differences: Studies have identified variants like Atropa belladonna var. flava and Atropa belladonna var. intermediata, which may contain sequence variations in the psbD gene affecting protein structure and function .

    2. Post-translational modifications: Chloroplast-expressed psbD undergoes modifications that may not be replicated in E. coli expression systems.

    3. Complex assembly: The functional PSII complex requires correct assembly with multiple protein partners and cofactors.

    4. Photodamage assessment: Measuring D2 protein turnover in response to photodamage requires sophisticated pulse-chase experiments.

    5. Experimental design considerations:

    ChallengeMethodological SolutionData Analysis Approach
    Expression system differencesUse multiple expression systems (E. coli, chloroplast transformation)Normalize based on properly assembled complexes rather than total protein
    Functional assessmentOxygen evolution measurements in reconstituted systemsCompare relative activities rather than absolute values
    Sequence variationsTargeted mutagenesis to introduce variant-specific changesCorrelate sequence differences with functional outputs
    Environmental responsesTest under varying light intensities and spectral qualitiesUse multivariate statistical analysis to identify condition-specific effects

    These challenges highlight the importance of combining in vitro studies of recombinant proteins with in vivo analyses in the native plant context .

  • How can advanced spectroscopic techniques enhance our understanding of recombinant Atropa belladonna psbD protein function?

    Advanced spectroscopic approaches provide critical insights into psbD protein function that cannot be obtained through conventional biochemical methods:

    1. Time-resolved fluorescence spectroscopy: Measures energy transfer kinetics within the assembled photosystem, allowing researchers to detect subtle functional differences between wild-type and variant psbD proteins.

    2. Electron paramagnetic resonance (EPR) spectroscopy: Detects paramagnetic species formed during electron transport, providing information about the redox states of cofactors associated with the D2 protein.

    3. Fourier-transform infrared (FTIR) spectroscopy: Identifies protein conformational changes during the photosynthetic process.

    4. Resonance Raman spectroscopy: Provides vibrational information about pigment-protein interactions.

    5. Transient absorption spectroscopy: Tracks ultrafast processes in photosynthetic electron transfer.

    Implementing these techniques requires:

    • Carefully isolated and purified protein samples

    • Reconstitution into appropriate membrane mimetic environments

    • Precisely controlled illumination conditions

    • Correlation of spectroscopic data with functional outputs

    These approaches have revealed that the D2 protein plays both structural and functional roles in coordinating electron transport cofactors and maintaining the optimal architecture of the PSII reaction center .

  • What methodologies are most effective for studying the role of psbD in photoprotection mechanisms under stress conditions?

    Investigating the role of psbD in photoprotection requires integrating multiple experimental approaches:

    1. Site-directed mutagenesis: Targeting residues involved in binding photoprotective pigments or participating in damage-repair cycles.

    2. Reconstitution experiments: Incorporating wild-type and mutant psbD proteins into liposomes with varying lipid compositions to mimic different stress conditions.

    3. Reactive oxygen species (ROS) detection: Using fluorescent probes to measure ROS production in assembled complexes.

    4. Pulse-amplitude modulation (PAM) fluorometry: Measuring non-photochemical quenching capacity of reconstituted systems.

    5. Thermal stability assays: Assessing protein unfolding under elevated temperatures.

    6. Experimental design matrix for stress testing:

    Stress ConditionMeasurement ParametersExpected psbD Response
    High light intensityPhotoinhibition rate, D2 turnoverIncreased protein degradation, modified electron transport
    Temperature extremesThermal stability, complex integrityConformational changes affecting cofactor binding
    Oxidative stressROS production, antioxidant capacityModified redox properties of associated cofactors
    Drought simulationLipid-protein interactionsAltered membrane association and complex stability

    These methods collectively provide insights into how the D2 protein contributes to PSII resilience under environmental stress, with particular relevance to understanding photosynthetic adaptation in Atropa belladonna's diverse growing conditions .

  • How does the transcriptomic and proteomic context of Atropa belladonna influence psbD expression and function?

    Recent transcriptomic analyses of Atropa belladonna have revealed complex regulatory networks affecting psbD expression and function:

    1. Transcriptome assembly: A novel de novo transcriptome assembly for Atropa belladonna has identified co-expressed genes involved in photosynthesis and secondary metabolism .

    2. Regulatory elements: RNA-binding proteins and small RNAs have been identified that may regulate psbD translation and stability.

    3. Integration with secondary metabolism: Correlations between photosynthetic gene expression (including psbD) and tropane alkaloid biosynthesis suggest metabolic integration.

    4. Stress response networks: Transcriptomic data reveals coordinated regulation of photosynthetic components, including psbD, in response to environmental stressors.

    5. Developmental regulation: Expression patterns throughout plant development indicate tissue-specific and developmental stage-specific regulation of photosynthetic genes.

    These findings highlight the importance of considering the broader cellular context when studying recombinant psbD protein. The protein's function in planta may be modulated by interactions with regulatory molecules and metabolic networks that are absent in simplified recombinant systems. Researchers should consider complementing in vitro studies with transcriptomic and proteomic analyses of native tissues to fully understand the protein's biological context .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.