Recombinant Atropa belladonna Photosystem Q (B) protein (psbA)

Shipped with Ice Packs
In Stock

Description

Introduction

The Recombinant Atropa belladonna Photosystem Q(B) protein (psbA) is a genetically engineered variant of the D1 protein, a critical component of Photosystem II (PSII) in oxygenic photosynthesis. This protein facilitates electron transfer by binding plastoquinone at the Q<sub>B</sub> site, enabling the conversion of light energy into chemical energy . The recombinant form is widely used in structural biology, herbicide research, and biopharmaceutical quality control .

Photosynthesis Studies

  • Electron Transfer Mechanism: Structural studies at 1.95–2.10 Å resolution reveal how psbA binds artificial electron acceptors (e.g., 2-phenyl-1,4-benzoquinone) at the Q<sub>B</sub> site, influencing oxygen-evolving activity .

  • Herbicide Resistance: Mutational analyses show that psbA variants alter herbicide binding efficiency, aiding agrochemical development .

Biopharmaceutical Production

  • Host Cell Protein (HCP) Detection: Recombinant psbA is a contaminant in plant-based vaccine production (e.g., SARS-CoV-2 RBD-Fc), requiring stringent quality control .

Expression Systems

  • Prokaryotic: Expressed in E. coli with N-terminal His tags for affinity purification .

  • Eukaryotic: Produced in yeast (Pichia pastoris) for higher yields .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipment, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. We recommend storing working aliquots at 4°C for a maximum of one week.
Reconstitution
Prior to opening, we suggest briefly centrifuging the vial to concentrate the contents at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your use.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Atropa belladonna (Belladonna) (Deadly nightshade)
Target Names
psbA
Target Protein Sequence
MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Atropa belladonna psbA protein and what is its role in photosynthesis?

The psbA gene in Atropa belladonna, similar to other photosynthetic organisms, encodes the D1 protein of photosystem II (PSII). This protein plays a crucial role in the electron transport chain during photosynthesis. D1 is a core component of the PSII reaction center, where it binds cofactors needed for the primary photochemistry, including the manganese cluster responsible for water oxidation. The protein undergoes rapid turnover due to light-induced damage, particularly under high light conditions, making it a key factor in photoinhibition and photoprotection mechanisms. Studies in cyanobacteria have shown that the PsbA (D1) protein is essential for maintaining photosynthetic efficiency by enabling electron transfer from water to plastoquinone .

How does the Atropa belladonna photosystem II structure compare to other plant species?

The photosystem II structure in Atropa belladonna shares fundamental similarities with other plant species, containing core proteins including D1 (PsbA), D2 (PsbD), CP43 (PsbC), and CP47 (PsbB) . The CP47 chlorophyll apoprotein (PsbB) in A. belladonna serves as an internal antenna that transfers excitation energy to the reaction center. While the general architecture is conserved across photosynthetic organisms, species-specific variations exist in protein sequences that may influence the photosynthetic efficiency and environmental adaptations. For instance, the recombinant A. belladonna Photosystem II CP47 chlorophyll apoprotein (psbB) has been isolated and characterized, indicating that photosystem research in this species has advanced to enable recombinant protein production and analysis .

What techniques are typically used to isolate PSII complexes from Atropa belladonna?

Isolation of PSII complexes from Atropa belladonna typically follows protocols similar to those used for other plant species, with modifications to account for the specific characteristics of this nightshade family member. The general methodology includes:

  • Tissue homogenization in isolation buffer containing protease inhibitors

  • Differential centrifugation to separate thylakoid membranes

  • Detergent solubilization (typically using n-dodecyl β-D-maltoside or Triton X-100)

  • Sucrose gradient ultracentrifugation or column chromatography for complex purification

For recombinant protein production, expression systems using E. coli, yeast, baculovirus, or mammalian cells may be employed, with the recombinant protein subsequently purified to >90% purity as referenced for the PsbB protein . Storage stability is maintained by keeping the purified protein at -20°C for long-term storage, with working aliquots stored at 4°C for up to one week .

How can mass spectrometry be optimized for quantification of alternative PsbA protein isoforms in Atropa belladonna?

Mass spectrometry-based quantification of alternative PsbA isoforms requires specialized techniques due to the high sequence similarity between protein variants. Based on successful approaches with other species, researchers should consider:

The precise quantification achieved through these methods allows researchers to correlate transcript levels with actual protein abundance under various environmental conditions, providing insight into the dynamics of photosystem protein turnover .

What methods can be used to create knockout mutants of specific psbA gene family members in Atropa belladonna?

Creating knockout mutants in the psbA gene family of Atropa belladonna would follow principles similar to those applied in other photosynthetic organisms, with adaptations for this specific plant species:

  • Gene targeting construct design: Create plasmids containing:

    • Upstream and downstream homologous regions of the target psbA gene

    • Selection marker (e.g., antibiotic resistance cassette like chloramphenicol or spectinomycin/streptomycin)

    • The construct should replace most parts of the target gene with the resistance cassette

  • Transformation methods:

    • Agrobacterium-mediated transformation

    • Particle bombardment

    • Protoplast transformation with PEG-calcium

  • Selection and verification:

    • Culture on selective media with appropriate antibiotics

    • PCR verification of gene deletion

    • RT-PCR to confirm absence of target transcript

    • Mass spectrometry to verify protein absence

As demonstrated in work with Thermosynechococcus elongatus, such knockout mutants enable detailed characterization of the specific roles of individual PsbA copies in photosynthesis, both at the whole-cell level and in isolated PSII complexes .

How do environmental stressors affect the expression patterns of different psbA genes in Atropa belladonna?

While specific data for Atropa belladonna is limited in the provided search results, research on other photosynthetic organisms indicates that environmental stressors significantly impact psbA gene expression patterns. Based on findings in cyanobacteria and other plants, the following patterns can be anticipated:

Research in cyanobacteria has shown that high light exposure causes dramatic shifts in the PsbA protein pool, with the stress-responsive isoform increasing from ~3% to ~42% after just 1.5 hours of high light treatment, eventually reaching ~70% of the total PsbA pool after longer exposure . Similar dynamic responses likely occur in A. belladonna in response to environmental stressors.

What are the optimal culture conditions for maximizing recombinant photosystem protein expression in Atropa belladonna?

For optimal recombinant photosystem protein expression in heterologous systems using Atropa belladonna genes, researchers should consider:

  • Expression system selection:

    • E. coli systems: Suitable for initial studies but may lack post-translational modifications

    • Yeast: Offers eukaryotic processing capabilities

    • Baculovirus: Higher yield of correctly folded membrane proteins

    • Mammalian cells: Most complex but potentially highest fidelity for plant proteins

  • Growth parameters:

    • Temperature: Generally maintained at 37°C for E. coli, 30°C for yeast, and 27°C for insect cells

    • Media composition: Enriched media supplemented with appropriate inductors

    • For plant-based expression: 45°C growth temperature with CO2-enriched air has been effective for photosynthetic organisms

  • Induction and harvesting timing:

    • Monitor growth curves to determine optimal induction point

    • Harvest timing is critical as premature or delayed collection can significantly impact yield

For isotopic labeling studies, modified growth media containing 15NH4Cl as the sole nitrogen source can be employed, though this may affect growth rates and requires optimization for A. belladonna-derived proteins .

How can researchers effectively measure the functional differences between PsbA variants in Atropa belladonna?

To effectively measure functional differences between PsbA variants, researchers can employ multiple complementary techniques:

  • Thermoluminescence and delayed fluorescence measurements:

    • These techniques can detect shifts in the free energy between redox pairs

    • Can reveal differences in electron transfer properties between PsbA variants

    • Allow for assessment in both whole cells and isolated PSII complexes

  • Flash-induced fluorescence decay:

    • Measures the kinetics of electron transfer from QA to QB

    • Can reveal differences in electron transport efficiency between variants

  • Photoinhibition assays:

    • Exposure to high light intensity followed by measurement of PSII activity

    • Quantifies the relative resistance of different PsbA variants to photodamage

    • Can be assessed through oxygen evolution measurements or chlorophyll fluorescence

  • Redox potential measurements:

    • Direct electrochemical methods to determine the redox potential of cofactors

    • Can reveal if PsbA variants alter the energetics of electron transfer components

Research with cyanobacterial PsbA variants has demonstrated that different isoforms can exhibit altered redox properties of photosystem components, such as shifts in pheophytin redox potential, which ultimately affect photoprotection capabilities . Similar methodologies would be valuable for characterizing A. belladonna PsbA variants.

What are the challenges in studying post-translational modifications of photosystem proteins in Atropa belladonna?

Studying post-translational modifications (PTMs) of photosystem proteins in Atropa belladonna presents several methodological challenges:

  • Sample preparation issues:

    • Membrane proteins are inherently difficult to extract and purify

    • PTMs may be lost during harsh extraction procedures

    • Native PTM state must be preserved during isolation

  • Analytical limitations:

    • Some PTMs are substoichiometric or transient

    • Multiple PTMs may occur on the same protein, creating combinatorial complexity

    • Mass spectrometry detection requires specialized approaches for hydrophobic membrane proteins

  • Biological interpretation challenges:

    • Determining which PTMs are functionally relevant versus those that are artifacts

    • Establishing the temporal dynamics of modifications in response to environmental conditions

    • Connecting specific PTMs to functional changes in photosystem activity

To address these challenges, researchers typically employ enrichment strategies for modified peptides, specialized mass spectrometry techniques such as electron transfer dissociation (ETD) that preserve labile PTMs, and careful correlation with functional assays to establish physiological relevance. The development of site-specific antibodies for important PTMs can also facilitate monitoring modification states under various conditions.

How should researchers interpret contradictory results between transcript levels and protein abundance for photosystem components?

When researchers encounter contradictions between transcript levels and protein abundance for photosystem components, several factors should be considered in the interpretation:

  • Temporal dynamics: Transcript changes typically precede protein changes. As observed in studies of cyanobacterial PsbA proteins, a 1.5-hour high light treatment resulted in ~98% of the transcript pool consisting of the stress-responsive isoform, while only ~42% of the protein pool had changed . This lag between transcriptional and translational responses must be accounted for in experimental design and interpretation.

  • Post-transcriptional regulation: Multiple mechanisms can influence the relationship between mRNA and protein levels:

    • mRNA stability differences between transcripts

    • Differential translation efficiency

    • microRNA-mediated regulation

    • RNA-binding protein influences

  • Protein turnover considerations: The steady-state level of a protein represents the balance between synthesis and degradation. D1 protein has an unusually high turnover rate compared to other photosystem components, which complicates direct transcript-protein correlations.

  • Methodological limitations: Technical issues in quantification can create apparent contradictions:

    • Different sensitivities of transcript versus protein detection methods

    • Challenges in distinguishing highly similar protein isoforms

Researchers should design time-course experiments that capture both transcript and protein dynamics to properly interpret these relationships, as demonstrated in studies showing that protein levels may continue to change hours after transcript levels have stabilized .

What statistical approaches are most appropriate for analyzing mass spectrometry data from Atropa belladonna photosystem protein studies?

For robust analysis of mass spectrometry data from Atropa belladonna photosystem protein studies, researchers should consider these statistical approaches:

  • Normalization methods:

    • Total ion current (TIC) normalization

    • Reference peptide normalization

    • NSAF (Normalized Spectral Abundance Factor) for relative quantification

    • Internal standards for absolute quantification

  • Statistical tests for differential abundance:

    • Student's t-test for simple two-condition comparisons

    • ANOVA with post-hoc tests for multi-condition experiments

    • Non-parametric alternatives (Mann-Whitney U, Kruskal-Wallis) when normality cannot be assumed

  • Multiple testing correction:

    • Benjamini-Hochberg procedure to control false discovery rate (FDR)

    • Bonferroni correction when strict family-wise error rate control is required

  • Multivariate methods for complex datasets:

    • Principal Component Analysis (PCA) to identify major sources of variation

    • Partial Least Squares Discriminant Analysis (PLS-DA) for supervised classification

    • Hierarchical clustering to identify co-regulated proteins

  • Specialized approaches for highly homologous proteins:

    • Unique peptide-based quantification

    • MS1 filtering for isoform-specific peptides

    • Parallel reaction monitoring (PRM) for targeted quantification of specific variants

The choice of statistical approach should be guided by the experimental design, the specific questions being addressed, and the nature of the data. For time-course experiments examining photosystem protein dynamics, mixed-effects models may be particularly appropriate to account for both fixed and random effects in the experimental system.

How can researchers differentiate between genuine biological variation and technical artifacts when studying photosystem protein complexes?

Differentiating between genuine biological variation and technical artifacts in photosystem protein complex studies requires systematic approaches:

  • Experimental design strategies:

    • Include appropriate biological and technical replicates

      • Minimum of 3 biological replicates recommended

      • At least 2 technical replicates per biological sample

    • Implement randomization to avoid batch effects

    • Include quality control samples processed identically to experimental samples

  • Quality control measures:

    • Monitor reproducibility of retention times and peak intensities

    • Track internal standards across all samples

    • Assess sample preparation variability using coefficient of variation (CV) analysis

    • Employ quality metrics specific to mass spectrometry (e.g., mass accuracy, fragmentation quality)

  • Validation approaches:

    • Confirm key findings using orthogonal techniques (e.g., Western blotting, enzyme assays)

    • Compare results with independent datasets or published literature

    • Verify biological plausibility through pathway analysis

  • Data filtering and normalization:

    • Apply signal-to-noise thresholds

    • Remove peptides with high missing value rates

    • Implement appropriate normalization to account for systematic biases

  • Statistical validation:

    • Use permutation tests to establish significance thresholds

    • Implement bootstrapping approaches to evaluate result stability

    • Calculate false discovery rates for protein identifications

Researchers studying photosystem proteins must be particularly vigilant about artifacts that can arise during membrane protein isolation and analysis. The use of gentle detergents, careful temperature control, and protection from light during sample preparation can help preserve the native state of these sensitive complexes and reduce technical variability.

What are the most promising applications of gene editing technologies for studying psbA function in Atropa belladonna?

Gene editing technologies offer powerful approaches for advancing our understanding of psbA function in Atropa belladonna:

These technologies would enable creation of mutant lines similar to those developed in cyanobacteria, where knockout mutants have provided valuable insights into the specific functions of individual PsbA copies . The ability to create precise modifications would allow researchers to investigate the functional significance of amino acid differences between PsbA variants and their impact on photosynthetic efficiency and stress responses.

How might systems biology approaches enhance our understanding of photosystem protein interactions in Atropa belladonna?

Systems biology approaches offer comprehensive frameworks for understanding the complex interactions of photosystem proteins in Atropa belladonna:

  • Multi-omics integration:

    • Combining transcriptomics, proteomics, and metabolomics data

    • Correlation of photosystem protein dynamics with global cellular responses

    • Identification of regulatory networks controlling photosystem assembly and function

  • Protein-protein interaction mapping:

    • Co-immunoprecipitation coupled with mass spectrometry

    • Yeast two-hybrid or split-ubiquitin screens

    • Proximity labeling approaches (BioID, APEX)

    • These methods can reveal novel interactions between photosystem components and regulatory factors

  • Mathematical modeling approaches:

    • Kinetic modeling of electron transport processes

    • Flux balance analysis of energy distribution

    • Agent-based models of photosystem assembly and repair

  • Network analysis:

    • Construction of functional interaction networks

    • Identification of hub proteins and critical nodes

    • Perturbation analysis to predict system responses

  • Comparative systems approaches:

    • Cross-species analysis of photosystem regulation

    • Evolutionary insights into photosystem adaptation

    • Identification of conserved and species-specific features

By integrating multiple data types and analytical approaches, researchers can develop predictive models of how photosystem components respond to changing environmental conditions, identify critical control points, and ultimately design strategies to enhance photosynthetic efficiency in agricultural applications.

What potential biotechnological applications exist for engineered photosystem proteins from Atropa belladonna?

Engineered photosystem proteins from Atropa belladonna present several promising biotechnological applications:

  • Enhanced photosynthetic efficiency:

    • Modification of D1 protein to reduce photoinhibition

    • Engineering electron transfer components for improved energy conversion

    • Optimization of repair cycles to maintain performance under stress conditions

  • Bioenergy applications:

    • Coupling modified photosystems to hydrogen production

    • Enhancement of electron transfer to exogenous acceptors

    • Development of bio-hybrid devices for solar energy conversion

  • Environmental sensing systems:

    • Using photosystem components as sensitive biosensors for:

      • Environmental pollutants

      • Herbicides

      • Heavy metals

    • Development of field-deployable biosensors based on fluorescence changes

  • Pharmaceutical applications:

    • Controlled production of specialized metabolites

    • Potential therapeutic uses leveraging A. belladonna's unique biochemistry

    • Platform for producing modified tropane alkaloids

  • Synthetic biology integration:

    • Incorporation of photosystem modules into synthetic cellular systems

    • Development of light-responsive regulatory circuits

    • Creation of minimal photosynthetic systems for fundamental research

The development of these applications would require extensive characterization of native A. belladonna photosystem components and their properties, followed by rational engineering approaches based on structure-function relationships and systems-level understanding of photosynthetic processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.