Recombinant Autographa californica nuclear polyhedrosis virus Major envelope glycoprotein (GP64)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes; we will fulfill requests as possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise requested. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a specific tag, please inform us; we will prioritize your request.
Synonyms
GP64; GP67; ORF128; Major envelope glycoprotein; gp64
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-512
Protein Length
full length protein
Species
Autographa californica nuclear polyhedrosis virus (AcMNPV)
Target Names
GP64
Target Protein Sequence
AEHCNAQMKTGPYKIKNLDITPPKETLQKDVEITIVETDYNENVIIGYKGYYQAYAYNGG SLDPNTRVEETMKTLNVGKEDLLMWSIRQQCEVGEELIDRWGSDSDDCFRDNEGRGQWVK GKELVKRQNNNHFAHHTCNKSWRCGISTSKMYSRLECQDDTDECQVYILDAEGNPINVTV DTVLHRDGVSMILKQKSTFTTRQIKAACLLIKDDKNNPESVTREHCLIDNDIYDLSKNTW NCKFNRCIKRKVEHRVKKRPPTWRHNVRAKYTEGDTATKGDLMHIQEELMYENDLLKMNI ELMHAHINKLNNMLHDLIVSVAKVDERLIGNLMNNSVSSTFLSDDTFLLMPCTNPPAHTS NCYNNSIYKEGRWVANTDSSQCIDFSNYKELAIDDDVEFWIPTIGNTTYHDSWKDASGWS FIAQQKSNLITTMENTKFGGVGTSLSDITSMAEGELAAKLTSFMFGHVVNFVIILIVILF LYCMIRNRNRQY
Uniprot No.

Target Background

Function

GP64 is a class III viral fusion protein and envelope phosphoglycoprotein. It mediates the fusion of viral and host endosomal membranes, enabling viral entry into the host cell. Following receptor-mediated endocytosis, GP64 undergoes a conformational change to a fusion-competent state at low pH, releasing the nucleocapsid into the cytoplasm after cell fusion. GP64 may also play a role in viral budding.

Gene References Into Functions
Research References and Functional Insights
  1. Four critical residues in domain V (G438, W439, T452, and T456) are essential for membrane fusion, with G438 and W439 crucial for the pre-fusion conformation. PMID: 26655244
  2. Viral GP64 mediates viral entry into mammalian cells. PMID: 22190715
  3. Residues 271 and 292 are critical for binding to mammalian cells but not Sf9 insect cells. PMID: 22072779
  4. Intermolecular disulfide bonds in GP64 are not essential for membrane fusion or virion budding. PMID: 20573818
  5. The GP64 transmembrane domain is critical for trafficking, membrane fusion, virion budding, and viral infectivity. PMID: 18216100
  6. Amino acids 485-487 and 503-505 are important for cell surface expression, while 483-484 and 494-496 are crucial for virus budding. PMID: 19244324
  7. Conserved residues T463, G460, G462, and G474 are not required for membrane fusion but are important for budding and viral infectivity. PMID: 19692475
Database Links

KEGG: vg:1403961

Protein Families
Baculoviridae gp64 family
Subcellular Location
Virion membrane; Single-pass membrane protein. Host cell membrane; Single-pass membrane protein.

Q&A

What is GP64 and what is its essential role in baculovirus infection?

GP64 is the major envelope fusion protein of Autographa californica multicapsid nuclear polyhedrosis virus (AcMNPV) that mediates pH-dependent membrane fusion and host cell receptor binding. It is absolutely essential for viral infection, as demonstrated through gene inactivation studies. When the gp64 efp gene is inactivated, the virus cannot complete its infection cycle successfully . This protein is responsible for two critical functions:

  • Binding to host cell receptors during initial viral attachment

  • Facilitating pH-dependent membrane fusion during viral entry through endocytosis

Methodologically, the essential nature of GP64 can be verified through the construction of GP64-null viruses using stably transfected insect cell lines (like SfpOP64-6) that constitutively express GP64 to complement the deficiency during virus construction .

How is the GP64 protein structurally organized and what are its key functional domains?

The GP64 protein contains distinct functional domains with specific roles in viral infection:

  • Leader peptide/signal sequence: Directs the protein to the secretory pathway

  • Receptor-binding domain (amino acids 21-294): Mediates attachment to host cells, with residues 140-161 comprising the core receptor-binding pocket

  • Fusion domain: Facilitates membrane fusion during viral entry

  • Transmembrane domain: Anchors the protein in the viral envelope

  • Cytoplasmic tail: Involved in protein trafficking and virion incorporation

According to crystallographic studies, GP64 has surface-exposed regions that are particularly important for function. Mutations in these regions can significantly impact viral infectivity. For example, the E45K mutation likely disrupts hydrogen bond interaction networks involving Lys-317 and Lys-44, potentially facilitating interactions with negatively charged cell surfaces .

What experimental approaches are most effective for studying GP64 trafficking to the cell surface?

Several methodological approaches have proven effective for studying GP64 trafficking:

  • Development of stable cell lines: Creating cell lines that express GP64 under inducible conditions allows for controlled studies of protein trafficking. For example, copper-inducible systems have been utilized where Cu₂SO₄ concentrations between 50-400 μM provide optimal expression for trafficking studies .

  • RNAi knockdown screening: Using RNAi to target host factors potentially involved in GP64 trafficking. The Z-factor calculation (Z = 0.67 for Rab1 knockdown effects) demonstrates this is a highly effective method for identifying cellular factors involved in GP64 surface display .

  • Surface biotinylation assays: Allows quantification of GP64 that has successfully reached the plasma membrane.

  • Immunofluorescence microscopy: Enables visualization of GP64 localization within cells at different time points post-induction or infection.

When designing trafficking studies, it's crucial to optimize induction timing and detection methods. For instance, measuring GP64 surface levels at 8 hours post-induction with varying concentrations of inducer can provide a sensitive assay window for detecting trafficking defects .

How does the minicistron upstream of the GP64 ORF affect translation efficiency?

The AcMNPV gp64 gene contains a small upstream open reading frame (minicistron) that encodes a five-amino-acid peptide (MPQCY) found only on late mRNAs. This minicistron plays a significant role in translational regulation of GP64.

To study the effects of this minicistron on translation:

  • Create reporter gene constructs with the gp64 promoter region and a gp64-cat fusion in the polyhedrin locus

  • Introduce point mutations to inactivate the minicistron

  • Monitor effects through CAT assays and quantitative immunoprecipitation

Research has shown that by 24 hours post-infection, approximately 78% of GP64 protein detected is expressed during the late phase and is therefore subject to potential translational regulation by the minicistron .

Phase of InfectionPercentage of GP64 ExpressionmRNA Source
Early~22%Early promoter
Late~78%Late promoters (containing minicistron)

This research approach allows for isolation of the minicistron's effects on translational efficiency, providing insights into baculovirus gene expression regulation mechanisms .

What are the optimal insertion sites for foreign peptides in GP64 for surface display on baculovirus?

For efficient display of foreign peptides on the baculovirus surface through GP64 modification, specific insertion sites have been identified through systematic testing.

A comprehensive approach involves:

  • Selecting insertion sites based on maximum surface probability predictions

  • Creating multiple insertion constructs with marker peptides (e.g., the ELDKWA peptide of HIV-1 gp41)

  • Evaluating display efficiency through Western blotting, FACS analysis, and ELISA

Research has shown that while many positions can accommodate insertions, certain sites provide superior presentation. For example, when testing 17 different positions for the ELDKWA peptide insertion, 13 successfully produced intact virus particles while 4 positions failed to yield viable virions .

The most effective insertion sites are typically in surface-exposed loops that don't disrupt critical structural elements or functional domains. Successful insertions have been achieved by placing foreign sequences between the leader peptide and the mature protein .

How can directed evolution be used to improve GP64's host range or cell-type specificity?

Directed evolution offers a powerful approach to modify GP64 for enhanced performance in specific cell types. A methodical approach includes:

  • Generate a diverse library of GP64 variants using error-prone PCR focused on the receptor-binding domain (amino acids 21-294)

  • Package the library into viral vectors where each virion displays a unique GP64 variant

  • Serially passage the library on target cells (e.g., human airway epithelial cells)

  • Extract genomic DNA, amplify GP64 sequences, and create a new library for subsequent rounds

  • Repeat until convergence of mutations is observed (typically 5 passages)

This method has successfully identified key mutations enhancing GP64 function in human airway epithelial cells. For example, three single-point mutations (E45K, G165D, and T259A) and their combinations were identified after five passages .

MutationAppearance FrequencyTiter (TU ml⁻¹)
Wild type-5.6 × 10⁸
E45K21.2 × 10⁸
G165D141.1 × 10⁸
T259A11.8 × 10⁸
E45K/G165D21.9 × 10⁸
G165D/T259A10.9 × 10⁸
E45K/T259A01.1 × 10⁸
E45K/G165D/T259A04.1 × 10⁸

The G165D mutation appeared most frequently (14 times), suggesting its importance in cell entry, though functional experimentation showed that combinations with other mutations (particularly E45K/G165D or G165D/T259A) substantially increased transduction efficiency .

Which cellular factors are essential for proper GP64 trafficking and incorporation into virions?

Identifying cellular factors involved in GP64 trafficking requires a systematic screening approach:

  • Develop a stable cell line expressing inducible GP64

  • Establish quantitative assays for GP64 surface expression

  • Perform targeted RNAi knockdowns of candidate trafficking factors

  • Measure differential effects on GP64 surface levels

Research has shown that Rab GTPases, particularly Rab1, play critical roles in GP64 trafficking. When optimizing such screens, it's important to calibrate induction conditions (e.g., Cu₂SO₄ concentration) to provide maximum sensitivity for detecting trafficking defects .

The calculated Z-factor of 0.67 for Rab1 knockdown effects indicates an excellent high-throughput assay for identifying genes that modulate GP64 trafficking and surface display . A complete trafficking pathway analysis would involve:

  • ER-to-Golgi transport factors (COPII components, Rab1)

  • Intra-Golgi trafficking proteins (COG complex)

  • Post-Golgi sorting machinery (adaptor proteins, Rab11)

  • Plasma membrane targeting factors (exocyst complex)

What controls should be included when constructing GP64-null viruses for functional studies?

When creating GP64-null viruses to study GP64 function, several critical controls must be incorporated:

  • Complementation control: Verify that GP64-null phenotypes can be rescued by providing GP64 in trans, often through stably transfected cell lines expressing GP64 (e.g., SfpOP64-6)

  • Insertion site verification: Confirm that the insertion used to disrupt gp64 (e.g., lacZ insertion after codon 131) properly inactivates the gene while minimizing effects on flanking regions

  • Expression validation: Verify absence of GP64 expression through Western blotting and immunofluorescence in non-complementing cells

  • Infectious particle quantification: Compare budded virus production between wild-type and GP64-null viruses in complementing versus non-complementing cells

  • Gene replacement control: When the wild-type gp64 efp locus is replaced with an inactivated version, confirm proper homologous recombination without affecting other viral functions

This comprehensive set of controls ensures that any observed phenotypes are genuinely attributed to GP64 deficiency rather than secondary effects of genetic manipulation.

How can recombinant GP64 be engineered to display complex proteins while maintaining fusion functionality?

Engineering GP64 to display foreign proteins requires careful design considerations:

  • Insertion site selection: The region between the signal sequence and mature protein has been demonstrated to allow efficient secretion of fusion proteins, such as GST-GP64

  • Co-oligomerization strategy: Leverage the natural co-oligomerization of wild-type GP64 with modified versions to maintain fusion functionality while displaying foreign proteins

  • Expression vector optimization: Utilize specialized vectors like pAcSurf-2, which positions multiple cloning sites in-phase between the GP64 signal sequence and mature protein under polyhedrin promoter control

  • Functional validation: Test both surface display (through immunogold labeling) and fusion activity (through syncytia formation assays)

Research has shown that when GST was inserted between the leader peptide and mature protein, the hybrid GST-GP64 was efficiently secreted into cell medium and successfully incorporated onto the virion surface . Similarly, the HIV major surface glycoprotein gp120 was efficiently displayed in functional form using this approach.

How can contradictory findings regarding GP64 mutation effects be reconciled?

When analyzing conflicting data on GP64 mutations, consider these methodological approaches:

  • Contextual analysis: Examine whether mutations have different effects depending on the viral or cellular context. For instance, the G165D mutation appeared most frequently in directed evolution studies (14 times) but did not enhance cell entry as well as expected when tested individually

  • Combinatorial effects: Assess whether mutations have synergistic effects. The G165D mutation showed substantially increased transduction of human airway epithelial cells when combined with either E45K or T259A, despite modest effects alone

  • Structural mapping analysis: Map mutations onto the available crystal structure of GP64. For example, G165D lies in the middle of a β-sheet above a disulfide bond, and its mutation to the larger Asp likely clashes with neighboring Tyr-68, affecting structure and stability

  • Functional domain consideration: Consider whether contradictory findings relate to different functional domains. Residues 21-159 comprise a putative receptor-binding domain, making G165's proximity potentially important for cell entry, despite destabilizing effects

A comprehensive approach involves cross-validating findings through multiple methodologies, including surface display quantification, fusion assays, and structural biology techniques.

What methods can detect subtle changes in GP64 trafficking efficiency?

Detecting subtle changes in GP64 trafficking requires sensitive quantitative methods:

  • Optimization of induction parameters: Establish a range of inducer concentrations (e.g., 50-400 μM Cu₂SO₄) that provides a sensitive window for detecting trafficking differences

  • Flow cytometry quantification: Use surface staining and flow cytometry to precisely measure the percentage of GP64 that reaches the cell surface

  • Pulse-chase analyses: Track the kinetics of GP64 movement through cellular compartments using radioactive or fluorescent labeling

  • Comparative RNAi knockdown analysis: Use known trafficking disruptors (like Rab1) as positive controls to calibrate detection sensitivity. A calculated Z-factor of 0.67 indicates excellent sensitivity for high-throughput screening

  • Live-cell imaging: Monitor GFP-tagged GP64 trafficking in real-time using confocal microscopy

When designing experiments, it's important to account for expression level variations by normalizing surface measurements to total GP64 expression, ensuring that observed differences reflect trafficking efficiency rather than expression differences.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.