Recombinant Avahi cleesei NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes and we will fulfill it if possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us and we will prioritize developing it accordingly.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Avahi cleesei (Cleese's woolly lemur) (Bemaraha woolly lemur)
Target Names
Target Protein Sequence
MNLSLTLMTDVALALLLVMIAFWLPQLNIYTEKYSSYECGFDPMGSARLPFSMKFFLVAI TFLLFDLEIALLLPLPWASQTTNLKLMLTMALLLISILAAGLAYEWSQKGLEWEE
Uniprot No.

Target Background

Function
This protein is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. MT-ND3 is essential for the catalytic activity of complex I.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND3 and what is its biological significance?

MT-ND3 (mitochondrial NADH dehydrogenase subunit 3) is a gene of the mitochondrial genome that encodes the NADH dehydrogenase 3 protein. This protein functions as a critical subunit of NADH dehydrogenase (ubiquinone), also known as Complex I, which is located in the mitochondrial inner membrane and represents the largest of the five complexes in the electron transport chain . The biological significance of MT-ND3 lies in its essential role in cellular energy production through oxidative phosphorylation. As one of seven mitochondrially encoded subunits of Complex I (along with MT-ND1, MT-ND2, MT-ND4, MT-ND4L, MT-ND5, and MT-ND6), it forms part of the core hydrophobic transmembrane region of this enzyme complex . In various organisms, including Avahi cleesei, MT-ND3 participates in the electron transfer pathway that ultimately couples NADH oxidation to energy production.

What are the recommended protocols for reconstitution and storage of recombinant Avahi cleesei MT-ND3?

For optimal handling of recombinant Avahi cleesei MT-ND3, researchers should follow these methodological steps:

Reconstitution Protocol:

  • Briefly centrifuge the vial containing lyophilized protein to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being the default recommendation)

  • Aliquot the reconstituted protein for long-term storage

Storage Conditions:

  • Store received product at -20°C/-80°C

  • Aliquot reconstituted protein to minimize freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • Long-term storage should be at -20°C/-80°C in glycerol-containing buffer

The protein is typically provided in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . It's crucial to note that repeated freeze-thaw cycles are not recommended as they may compromise protein integrity and functionality. When placing orders, researchers can specify their preference for either liquid or lyophilized powder format, although availability may dictate the format provided .

What methods are recommended for detecting genetic variations in MT-ND3?

For researchers investigating genetic variations in MT-ND3 genes, PCR amplification followed by Sanger sequencing represents the standard methodological approach. Based on established protocols:

  • Primer Design: Design PCR primers using online tools such as Primer 3.0 (http://primer3.ut.ee)

    • Example forward primer: 5′-CCACAACTCAACGGCTACAT-3′

    • Example reverse primer: 5′-TGGGTGTTGAGGGTTATGAG-3′

  • PCR Amplification: Generate amplicons (approximately 491 bp for the referenced human study) using standard PCR protocols

  • Sequencing: Sequence PCR products using the same PCR primers with BigDye® Terminator v3.1 Cycle Sequencing Kit on an ABI PRISM 3730XL system or comparable equipment

  • Analysis: Detect SNPs through sequence analysis based on appropriate reference sequences

    • For human MT-ND3, the reference sequence is human MT: 10398 (GenBank accession number: NC_012920)

    • For Avahi cleesei, the appropriate reference sequence should be used

This methodology has successfully identified several SNPs in human MT-ND3, including rs28358278, rs2853826, rs201397417, rs41467651, and rs28358275 . Researchers working with Avahi cleesei samples would need to adapt these protocols using species-specific reference sequences.

What experimental applications can recombinant Avahi cleesei MT-ND3 be used for?

The recombinant Avahi cleesei MT-ND3 protein can be utilized in various experimental applications, including but not limited to:

  • SDS-PAGE Analysis: The primary application listed for the commercial recombinant protein is SDS-PAGE , which allows for:

    • Confirmation of protein purity and molecular weight

    • Comparative analysis with MT-ND3 from other species

    • Quality control during purification processes

  • Structural Studies: As a component of Complex I, the protein could be used in:

    • Crystallization attempts for structural determination

    • Cryo-EM studies of Complex I assembly

    • Protein-protein interaction analyses

  • Functional Assays: When incorporated into appropriate experimental systems:

    • Electron transfer activity measurements

    • Complex I assembly studies

    • Inhibitor binding assays

  • Antibody Production: The purified protein can serve as an antigen for:

    • Generation of specific antibodies against Avahi cleesei MT-ND3

    • Development of immunodetection methods

  • Evolutionary Studies: Comparative analysis with MT-ND3 from other species for:

    • Phylogenetic research

    • Conservation analysis of functional domains

When designing experiments, researchers should consider that the recombinant protein has a purity greater than 90% as determined by SDS-PAGE , which is sufficient for many research applications but may require additional purification steps for certain high-sensitivity experiments.

What is the connection between MT-ND3 polymorphisms and human diseases?

MT-ND3 polymorphisms have been implicated in various human diseases, highlighting the clinical significance of this mitochondrial gene. Research has established connections with several conditions:

  • Mitochondrial Encephalomyopathy, Lactic Acidosis, and Stroke-like Episodes (MELAS): Variants in MT-ND3 are associated with this progressive neurodegenerative disorder that affects multiple body systems .

  • Leigh's Syndrome (LS): This severe neurological disorder characterized by progressive loss of mental and movement abilities has been linked to MT-ND3 variants .

  • Leber's Hereditary Optic Neuropathy (LHON): This maternally inherited condition causing vision loss has established associations with MT-ND3 mutations .

  • Type 2 Diabetes Mellitus (T2DM): The single nucleotide polymorphism at locus rs2853826 in MT-ND3 has been reported to increase reactive oxygen species (ROS) production in T2DM patients .

  • Cancer Susceptibility: Significant correlations have been found between MT-ND3 polymorphisms and the risk of multiple cancers, including breast and esophageal cancers . Research has also investigated potential associations with gastric cancer, though findings have been variable .

  • Parkinson's Disease: Studies have identified correlations between MT-ND3 polymorphisms and Parkinson's disease risk .

The pathogenic mechanisms of these associations likely involve altered mitochondrial function, disrupted electron transport chain efficiency, and increased oxidative stress. While these findings are based on human MT-ND3 studies, they provide valuable research directions for investigating potential disease associations of MT-ND3 variations in other species, including Avahi cleesei.

How can recombinant MT-ND3 be used to study mitochondrial complex function?

Recombinant MT-ND3, including the Avahi cleesei variant, serves as a valuable tool for studying mitochondrial Complex I function through several methodological approaches:

  • Reconstitution Studies: Researchers can incorporate recombinant MT-ND3 into artificially created membrane systems or partially assembled Complex I to study:

    • The role of MT-ND3 in complex assembly

    • Functional consequences of specific mutations

    • Contribution to the proton-pumping mechanism

  • Inhibitor Binding Analysis: Using recombinant MT-ND3 to:

    • Screen potential Complex I inhibitors

    • Map binding sites of known inhibitors

    • Develop species-specific inhibitors for research applications

  • Structural Studies: Recombinant protein can be used for:

    • Cryo-EM structure determination of Complex I

    • X-ray crystallography of subcomplexes

    • NMR studies of specific interactions

  • Comparative Functional Analysis: Researchers can compare:

    • MT-ND3 from different species to identify conserved functional regions

    • Wild-type versus mutant MT-ND3 to understand pathogenic mechanisms

    • MT-ND3 interactions with other Complex I subunits

For studying electron transfer mechanisms specifically, researchers might draw on methodologies similar to those used in investigating Na+-pumping NADH-ubiquinone oxidoreductase (Na+-NQR), which also couples electron transfer from NADH to ubiquinone with ion pumping . While Na+-NQR is structurally distinct from mitochondrial Complex I and found exclusively in prokaryotes, the experimental approaches to studying electron transfer pathways have valuable parallels.

What is the significance of studying Avahi cleesei MT-ND3 compared to other species?

Studying MT-ND3 from Avahi cleesei (Cleese's woolly lemur) offers unique research opportunities for several reasons:

  • Conservation Biology Applications: Avahi cleesei is an endangered species discovered in 2005 with a very small distribution and is at risk of extinction . Studying its mitochondrial genes contributes to:

    • Understanding genetic diversity within the remaining population

    • Developing conservation strategies

    • Establishing genetic markers for population monitoring

  • Evolutionary Biology Insights: As a member of the leaping lemur family (Indridae) , Avahi cleesei occupies an interesting position in primate evolution:

    • Comparative analysis of MT-ND3 across primates can reveal evolutionary patterns

    • Identification of species-specific adaptations in energy metabolism

    • Investigation of selection pressures on mitochondrial genes in different ecological niches

  • Comparative Biochemistry: Differences between Avahi cleesei MT-ND3 and that of other species may reveal:

    • Functional adaptations related to the species' unique physiology

    • Structural variations that influence Complex I efficiency

    • Species-specific interactions with other Complex I subunits

  • Methodological Development: Working with Avahi cleesei MT-ND3 promotes:

    • Development of molecular tools for non-model organisms

    • Refinement of comparative mitochondrial research techniques

    • Expansion of knowledge beyond commonly studied species

While human MT-ND3 has been extensively studied in relation to disease states, investigating MT-ND3 from endangered species like Avahi cleesei broadens our understanding of mitochondrial function across the tree of life and contributes to both basic science and conservation efforts.

How do mutations in MT-ND3 affect Complex I assembly and function?

Mutations in MT-ND3 can significantly impact both the assembly and function of mitochondrial Complex I through several mechanisms:

  • Assembly Defects:

    • Mutations may disrupt protein folding, leading to degradation before assembly

    • Altered interaction surfaces may prevent proper association with other Complex I subunits

    • Mutations in key regions might create assembly intermediates that fail to progress to complete Complex I formation

  • Functional Impairments:

    • Reduced electron transfer efficiency through disruption of the electron pathway

    • Altered proton pumping capacity affecting the proton gradient

    • Increased production of reactive oxygen species (ROS) due to electron leakage

  • Structural Consequences:

    • Changes in the hydrophobic transmembrane domain can affect membrane insertion

    • Mutations may alter the L-shaped structure of Complex I

    • Conformational changes could affect the interaction between the membrane arm and peripheral arm

The connections between MT-ND3 mutations and various diseases (such as MELAS, Leigh's syndrome, and LHON) highlight the critical nature of this protein in maintaining proper mitochondrial function . The specific SNP at locus rs2853826 in human MT-ND3, which has been linked to increased ROS production in type 2 diabetes mellitus, exemplifies how even single amino acid changes can have profound functional consequences .

For researchers investigating the effects of specific mutations, recombinant expression systems provide a valuable approach to produce both wild-type and mutant versions of MT-ND3 for comparative structural and functional studies.

What challenges exist in the expression and purification of recombinant MT-ND3?

The expression and purification of recombinant MT-ND3, including the Avahi cleesei variant, present several technical challenges that researchers must address:

  • Hydrophobicity Challenges:

    • MT-ND3 is highly hydrophobic as a transmembrane protein

    • Tendency to aggregate during expression and purification

    • Poor solubility in aqueous buffers without detergents or membrane mimetics

  • Expression System Optimization:

    • Prokaryotic expression (e.g., E. coli) may not provide appropriate folding environment

    • Codon optimization may be necessary for efficient expression

    • Toxicity to host cells if expression levels are too high

  • Purification Complexities:

    • Requirement for specialized detergents to maintain solubility

    • Potential for co-purification of host cell membrane proteins

    • Difficulty in removing all detergent without causing aggregation

  • Functionality Assessment:

    • Isolated MT-ND3 may not maintain native conformation outside Complex I

    • Functional assays require reconstitution into appropriate membrane environments

    • Protein-protein interactions may be lost during purification

The commercially available recombinant Avahi cleesei MT-ND3 addresses some of these challenges by:

  • Using an E. coli expression system for production

  • Incorporating an N-terminal His-tag for affinity purification

  • Achieving greater than 90% purity as determined by SDS-PAGE

  • Providing the protein in a stabilized form (lyophilized powder with Trehalose)

Researchers working with this protein should be aware that while these approaches mitigate some challenges, the recombinant protein may still require additional optimization for specific experimental applications, particularly those requiring functional activity.

How can researchers investigate the role of MT-ND3 in the electron transport mechanism of Complex I?

Investigating the specific role of MT-ND3 in the electron transport mechanism of Complex I requires sophisticated methodological approaches:

  • Site-Directed Mutagenesis Studies:

    • Systematically mutate conserved residues to identify those critical for electron transport

    • Create chimeric proteins with MT-ND3 segments from different species to map functional regions

    • Introduce disease-associated mutations to understand pathogenic mechanisms

  • Electron Paramagnetic Resonance (EPR) Spectroscopy:

    • Monitor the redox states of iron-sulfur clusters in Complex I

    • Track electron movement through the complex in the presence of wild-type or mutant MT-ND3

    • Identify potential electron leakage points associated with MT-ND3 mutations

  • Cryo-EM Structural Analysis:

    • Determine high-resolution structures of Complex I with various forms of MT-ND3

    • Map conformational changes during the catalytic cycle

    • Identify interaction points between MT-ND3 and other subunits

  • Molecular Dynamics Simulations:

    • Model electron movement through Complex I

    • Predict effects of MT-ND3 mutations on electron transport

    • Simulate interactions between MT-ND3 and other Complex I components

  • Inhibitor Binding Studies:

    • Similar to those used for Na+-NQR research, identify inhibitors that target MT-ND3

    • Map binding sites to understand functional regions

    • Use inhibitors as tools to dissect the electron transport pathway

Researchers could apply methodologies similar to those used in studying Na+-pumping NADH-ubiquinone oxidoreductase (Na+-NQR), which also couples electron transfer with ion pumping . While Na+-NQR is structurally distinct and found only in prokaryotes, the experimental approaches to studying the electron transfer pathway (NADH → FAD → 2Fe-2S → FMN → FMN → riboflavin → UQ) could inform similar investigations of Complex I electron transport.

What are the emerging techniques for studying MT-ND3 interactions within Complex I?

Several cutting-edge techniques are emerging for investigating MT-ND3 interactions within the larger Complex I structure:

  • Cross-linking Mass Spectrometry (XL-MS):

    • Identify interaction partners of MT-ND3 within Complex I

    • Map proximity relationships between proteins

    • Detect conformational changes under different functional states

  • Single-Particle Cryo-Electron Microscopy:

    • Achieve near-atomic resolution of the entire Complex I

    • Visualize MT-ND3 in its native environment

    • Track structural changes during electron transport

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Map solvent-accessible regions of MT-ND3

    • Identify conformational changes upon substrate binding

    • Detect interaction interfaces with other subunits

  • Super-Resolution Microscopy:

    • Visualize Complex I assembly in living cells

    • Track the incorporation of fluorescently labeled MT-ND3

    • Monitor dynamics of Complex I with wild-type vs. mutant MT-ND3

  • Nanoscale Thermophoresis:

    • Measure binding affinities between MT-ND3 and other Complex I components

    • Quantify effects of mutations on protein-protein interactions

    • Assess inhibitor binding kinetics

These emerging technologies complement traditional biochemical approaches and provide researchers with powerful tools to understand the complex role of MT-ND3 within the larger respiratory complex. The application of these techniques to Avahi cleesei MT-ND3 could reveal species-specific interaction patterns and functional adaptations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.