Recombinant Avahi cleesei NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Avahi cleesei NADH-Ubiquinone Oxidoreductase Chain 4L (MT-ND4L)

Recombinant Avahi cleesei NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L) is a genetically engineered protein subunit of mitochondrial Complex I, expressed in bacterial or cell-free systems. This protein is derived from Avahi cleesei (Cleese's woolly lemur), a primate species, and serves as a research tool for studying mitochondrial electron transport, disease mechanisms, and comparative evolutionary biology.

Amino Acid Sequence and Functional Domains

The recombinant MT-ND4L protein from Avahi cleesei contains the sequence:
MTPIFTNIILAFATAFLGTLIFRSHLMSSLLCLEGMmLSLFILSTLIILNMHLTVSFMMP ILLLVFAACEAAIGLALLVMVSNTYGLDYIKNLNLLQC .
This sequence aligns with the core transmembrane domain of Complex I, critical for proton pumping and electron transfer.

Functional Role in Complex I

MT-ND4L is a hydrophobic subunit embedded in the mitochondrial inner membrane, contributing to:

  1. Electron Transfer: Facilitates the transfer of electrons from NADH to ubiquinone.

  2. Proton Pumping: Participates in creating a proton gradient for ATP synthesis.

  3. Structural Stability: Forms part of the transmembrane "arm" of Complex I .

Comparative Evolutionary Studies

The Avahi cleesei MT-ND4L variant is used to:

  1. Investigate Mitochondrial Evolution: Compare subunit divergence across primates.

  2. Model Human Diseases: Study mutations analogous to human MT-ND4L-associated pathologies (e.g., Leber’s Hereditary Optic Neuropathy) .

Association with Human Diseases

While Avahi cleesei MT-ND4L is not directly linked to human disease, its homologs in humans (e.g., Homo sapiens MT-ND4L) are implicated in:

  • Leber’s Hereditary Optic Neuropathy (LHON): A T10663C mutation (Val65Ala) disrupts Complex I function, leading to optic nerve degeneration .

  • Metabolic Disorders: Variants correlate with obesity, diabetes, and hypertension .

Mechanistic Insights from Recombinant Studies

Recombinant MT-ND4L proteins help elucidate:

  • Mutation Effects: Structural or functional disruptions caused by amino acid substitutions.

  • Drug Targeting: Screening for compounds that restore Complex I activity in mutant models.

Functional Conservation Across Species

MT-ND4L’s role in Complex I is evolutionarily conserved, enabling cross-species comparisons to study:

  • Mitochondrial Efficiency: Variations in electron transport kinetics.

  • Disease Resistance: Primate models for testing therapeutic interventions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its implementation.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Avahi cleesei (Cleese's woolly lemur) (Bemaraha woolly lemur)
Target Names
Target Protein Sequence
MTPIFTNIILAFATAFLGTLIFRSHLMSSLLCLEGMMLSLFILSTLIILNMHLTVSFMMP ILLLVFAACEAAIGLALLVMVSNTYGLDYIKNLNLLQC
Uniprot No.

Target Background

Function
A core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as the electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of MT-ND4L in Avahi cleesei compared to other primates?

MT-ND4L (mitochondrially encoded NADH dehydrogenase 4L) is a critical component of Complex I (NADH:ubiquinone oxidoreductase) embedded in the inner mitochondrial membrane. This protein participates in the first step of the electron transport process, transferring electrons from NADH to ubiquinone during oxidative phosphorylation .

To compare MT-ND4L across species, researchers should:

  • Perform multiple sequence alignments using tools like MUSCLE or Clustal Omega

  • Calculate sequence identity/similarity percentages

  • Identify conserved domains and variable regions

  • Model protein structure using homology modeling tools

Methodologically, researchers investigating structural differences should combine in silico predictions with experimental validation through techniques like circular dichroism or NMR spectroscopy when possible.

What expression systems are most effective for producing recombinant Avahi cleesei MT-ND4L?

Production of functional recombinant MT-ND4L presents significant challenges due to its hydrophobic nature and mitochondrial origin. Based on research with similar mitochondrial proteins, the following expression systems have demonstrated varying degrees of success:

Expression SystemAdvantagesLimitationsOptimal Conditions
E. coli BL21(DE3)High yield, cost-effectiveInclusion body formation commonFusion with solubility tags (MBP, SUMO); low induction temperature (16-18°C)
Insect cells (Sf9, Hi5)Better folding of membrane proteinsHigher cost, longer production timeBaculovirus expression with C-terminal purification tag
Mammalian cells (HEK293, CHO)Native-like post-translational modificationsLowest yield, highest costInducible expression systems; supplemented media

Methodological approach should include:

  • Codon optimization for the chosen expression host

  • Inclusion of purification tags (His6, FLAG) that can be later removed

  • Careful consideration of detergents for membrane protein solubilization

  • Validation of protein folding and function after purification

When establishing expression protocols, researchers should monitor both expression levels and functional integrity through activity assays specific to Complex I .

How can researchers verify the functional activity of recombinant MT-ND4L?

Verifying functional activity of recombinant MT-ND4L requires assessing its ability to integrate into Complex I and contribute to electron transport. Researchers can employ the following methodological approaches:

  • NADH:ubiquinone oxidoreductase activity assay: Measure the rate of NADH oxidation spectrophotometrically at 340 nm in the presence of ubiquinone analogues. This can be conducted using purified recombinant protein reconstituted into liposomes or mitochondrial fractions .

  • Complementation studies: Express recombinant MT-ND4L in cell lines with MT-ND4L deficiency or mutations and assess restoration of Complex I activity.

  • Blue Native PAGE: Analyze proper integration into the Complex I assembly through gel electrophoresis combined with Western blotting.

  • Oxygen consumption measurements: Using oxygen electrodes to measure respiration rates in reconstituted systems or complemented cells.

For accurate functional assessment, researchers should include positive controls (wild-type human MT-ND4L) and negative controls (known non-functional mutants) in experimental designs.

What are the molecular mechanisms of species-specific differences in MT-ND4L function between Avahi cleesei and other primates?

Species-specific differences in MT-ND4L function likely result from evolutionary adaptations related to metabolic requirements and environmental pressures. To investigate these differences systematically, researchers should:

  • Conduct comprehensive phylogenetic analyses comparing MT-ND4L sequences across primate species, with particular attention to:

    • Non-synonymous versus synonymous substitution rates (dN/dS) to identify sites under selection

    • Mapping amino acid substitutions onto structural models

    • Correlation of substitutions with ecological and physiological adaptations

  • Develop chimeric proteins containing domains from different species to identify regions responsible for functional differences.

  • Perform site-directed mutagenesis to test the functional impact of specific amino acid substitutions.

  • Measure kinetic parameters (Km, Vmax) for electron transfer from NADH to ubiquinone for MT-ND4L from different species.

Advanced computational methods including molecular dynamics simulations can provide insights into how amino acid substitutions affect protein dynamics and interactions within Complex I. These simulations should be conducted over sufficient timescales (>100 ns) and validated experimentally when possible .

How does recombinant Avahi cleesei MT-ND4L interact with potential inhibitors compared to human MT-ND4L?

Understanding differential inhibitor interactions between species variants of MT-ND4L has significant implications for evolutionary biology and potential therapeutic development. Researchers investigating this question should employ a multi-faceted approach:

  • Comparative inhibition studies: Test a panel of known Complex I inhibitors (including benzopyrans and other classes) against recombinant Complex I containing either Avahi cleesei or human MT-ND4L. Determine IC50 values and inhibition kinetics for each compound .

  • Binding site analysis: Use photoaffinity labeling with derivatized inhibitors to identify specific binding residues.

  • Resistance profile characterization: Generate point mutations in conserved residues to identify those critical for inhibitor binding.

Inhibitor ClassExample CompoundsTypical Human IC50 RangeExpected Experimental Approach
Benzopyrans2,2-dimethylbenzopyran derivatives18-55 nMSpectrophotometric NADH oxidation assays
RotenoidsRotenone, deguelin1-20 nMOxygen consumption measurements
AcetogeninsAnnonacin, bullatacin5-50 nMCell-based viability assays with isolated mitochondria

The collected data should be analyzed to identify pharmacophore features that interact differently with Avahi cleesei MT-ND4L compared to human MT-ND4L. This information can provide evolutionary insights and potentially guide the development of species-specific Complex I modulators .

What role do post-translational modifications play in MT-ND4L function, and how can they be preserved in recombinant expression?

  • Identify natural PTMs in native MT-ND4L:

    • Isolate mitochondria from Avahi cleesei tissue samples (if available)

    • Perform mass spectrometry analysis to identify PTMs (phosphorylation, acetylation, etc.)

    • Compare PTM patterns between different primate species

  • Develop expression systems that preserve relevant PTMs:

    • For phosphorylation: Use mammalian expression systems with relevant kinases

    • For acetylation: Co-express with appropriate acetyltransferases

    • Consider cell-free systems supplemented with mitochondrial extracts

  • Evaluate functional consequences of specific PTMs:

    • Generate site-directed mutants that mimic or prevent specific PTMs

    • Assess effects on Complex I assembly, stability, and activity

    • Investigate potential regulatory roles under different metabolic conditions

When addressing this question experimentally, researchers should be aware that the mitochondrial environment differs from cytosolic conditions, and expression systems may need modification to accurately recapitulate the native state of MT-ND4L.

How do mutations in Avahi cleesei MT-ND4L correlate with potential mitochondrial disorders, and what insights can this provide for human disease models?

Mutations in human MT-ND4L have been associated with mitochondrial disorders such as Leber hereditary optic neuropathy (LHON) . Comparative analysis of Avahi cleesei MT-ND4L can provide evolutionary context for understanding pathogenic mutations. Researchers should:

  • Catalog natural sequence variations:

    • Compare MT-ND4L sequences across lemur species, including Avahi cleesei

    • Identify positions where human pathogenic mutations occur in the lemur sequence

    • Determine if lemurs possess compensatory mutations that mitigate potential pathogenic effects

  • Develop functional assays for mutation impact:

    • Express recombinant MT-ND4L containing specific mutations found in LHON patients

    • Measure effects on Complex I assembly, stability, and activity

    • Assess ROS production and mitochondrial membrane potential in cellular models

  • Create lemur-human chimeric proteins to test functional domains:

    • Replace human MT-ND4L segments with corresponding Avahi cleesei segments

    • Test if lemur sequences can rescue function of pathogenic human mutations

    • Identify potentially protective elements in the lemur sequence

This research approach can potentially identify natural variants in Avahi cleesei that might confer resistance to mutation effects seen in human mitochondrial disorders, providing new avenues for therapeutic development .

What are the optimal protocols for isolating native MT-ND4L from Avahi cleesei tissue samples?

Isolating native MT-ND4L from tissue samples presents significant challenges due to its hydrophobic nature and integration within Complex I. Researchers working with limited Avahi cleesei samples should consider the following optimized protocol:

  • Tissue preservation and preparation:

    • Flash-freeze tissue samples immediately in liquid nitrogen

    • Store at -80°C with protease inhibitors and antioxidants

    • Homogenize using gentle mechanical disruption in isotonic buffer

  • Mitochondrial isolation:

    • Perform differential centrifugation (600g → 7,000g → 10,000g)

    • Purify mitochondria using Percoll gradient centrifugation

    • Verify mitochondrial integrity through citrate synthase activity assay

  • Complex I extraction and MT-ND4L isolation:

    • Solubilize mitochondrial membranes with mild detergents (DDM or digitonin)

    • Isolate Complex I through blue native PAGE or immunoprecipitation

    • Extract MT-ND4L using specialized detergent mixtures or organic solvents

  • Verification methods:

    • Western blotting with antibodies against conserved MT-ND4L epitopes

    • Mass spectrometry for protein identification and characterization

    • N-terminal sequencing to confirm protein identity

When working with endangered species like Avahi cleesei, researchers should maximize data collection from minimal sample amounts and consider non-invasive alternatives when possible, such as using cultured cells derived from small tissue biopsies.

How can researchers design effective cross-species antibodies for detecting Avahi cleesei MT-ND4L?

Developing antibodies that effectively recognize Avahi cleesei MT-ND4L while maintaining specificity presents unique challenges. Researchers should employ the following methodological approach:

  • Epitope selection strategy:

    • Perform multiple sequence alignments of MT-ND4L across primates

    • Identify conserved regions between humans and lemurs

    • Select epitopes with:

      • High antigenicity scores

      • Surface accessibility in protein models

      • Minimal post-translational modification sites

  • Antibody development approach:

    • Consider developing monoclonal antibodies against synthesized peptides

    • Test both N-terminal and C-terminal directed antibodies

    • Validate with both recombinant protein and native samples when available

  • Validation protocol:

    • Test against recombinant Avahi cleesei MT-ND4L

    • Confirm specificity using Western blotting against mitochondrial fractions

    • Perform immunoprecipitation to verify protein-antibody interaction

    • Validate cross-reactivity with other primate species to determine specificity

  • Application optimization:

    • Determine optimal antibody concentration for each application

    • Test fixation conditions for immunohistochemistry applications

    • Optimize blocking conditions to minimize background

The most successful approach typically involves targeting highly conserved epitopes while carefully validating specificity against multiple species controls to ensure reliable detection of Avahi cleesei MT-ND4L.

What are the most effective computational methods to predict interactions between MT-ND4L and other Complex I subunits?

Predicting protein-protein interactions within Complex I requires sophisticated computational approaches. For studying MT-ND4L interactions, researchers should consider these methodological steps:

  • Homology modeling and structural prediction:

    • Generate a model of Avahi cleesei MT-ND4L based on known structures

    • Refine the model using molecular dynamics simulations

    • Validate model quality using metrics like RMSD, Ramachandran plots, and QMEAN scores

  • Protein-protein docking approaches:

    • Rigid body docking using tools like ZDOCK or ClusPro

    • Flexible docking with HADDOCK or RosettaDock

    • Energy minimization of docked complexes

  • Interaction hotspot prediction:

    • Use computational alanine scanning to identify key residues

    • Calculate binding free energies using MM/PBSA methods

    • Identify conserved interaction interfaces across species

  • Validation through experimental approaches:

    • Cross-linking coupled with mass spectrometry

    • FRET or PLA assays to confirm predicted interactions

    • Mutagenesis of predicted interface residues

Computational MethodStrengthsLimitationsBest Application
Homology modelingWorks well for conserved proteinsAccuracy depends on template qualityInitial structure prediction
Molecular dynamicsCaptures protein flexibilityComputationally intensiveRefinement and stability assessment
Molecular dockingPredicts binding modesMay miss dynamic interactionsInitial interaction screening
MM/PBSA calculationsProvides binding energeticsRequires accurate structuresQuantifying interaction strength

For MT-ND4L specifically, researchers should pay special attention to the hydrophobic transmembrane regions that are critical for assembly within Complex I but challenging to model accurately .

How has MT-ND4L evolved among different lemur species, and what does this reveal about mitochondrial adaptation?

MT-ND4L evolution among lemur species provides insights into mitochondrial adaptation to different ecological niches. Researchers investigating this question should:

  • Conduct comprehensive phylogenetic analysis:

    • Sequence MT-ND4L from multiple lemur species, including various Avahi species

    • Construct phylogenetic trees using maximum likelihood and Bayesian methods

    • Calculate evolutionary rates and identify branches under selection pressure

  • Correlate sequence variations with ecological factors:

    • Map habitat, diet, and activity patterns against sequence variations

    • Identify convergent evolution in lemurs with similar ecological niches

    • Analyze whether river barriers between lemur populations drive genetic divergence

  • Assess functional consequences of species-specific variations:

    • Express recombinant MT-ND4L from different lemur species

    • Compare enzymatic properties and stability characteristics

    • Evaluate performance under conditions mimicking different habitats

  • Investigate coevolution with nuclear-encoded Complex I subunits:

    • Analyze compensatory mutations between mitochondrial and nuclear genomes

    • Identify potential mismatches that might contribute to hybrid incompatibility

    • Test nuclear-mitochondrial interactions experimentally

This evolutionary perspective can provide valuable insights into how mitochondrial function adapts to different environmental pressures and contributes to speciation events among lemurs .

What insights can comparative analysis of Avahi cleesei MT-ND4L provide for understanding human mitochondrial disorders?

Comparative analysis between Avahi cleesei and human MT-ND4L offers a unique evolutionary perspective on mitochondrial disorders. Researchers should:

  • Map human pathogenic mutations onto the Avahi cleesei sequence:

    • Identify positions where known LHON mutations (e.g., T10663C/Val65Ala) occur in humans

    • Determine the native amino acids at these positions in Avahi cleesei

    • Analyze whether lemurs have potential compensatory mutations

  • Functional comparison methodology:

    • Express both wild-type and mutant forms of human and Avahi cleesei MT-ND4L

    • Measure impact on:

      • Complex I assembly and stability

      • NADH:ubiquinone oxidoreductase activity

      • ROS production

      • ATP synthesis

  • Investigate tissue-specific effects:

    • Examine why certain mutations predominantly affect the optic nerve

    • Compare tissue-specific expression patterns and energetic requirements

    • Assess potential protective mechanisms in lemur tissues

  • Develop experimental disease models:

    • Generate cell lines with "humanized" or "lemurized" MT-ND4L

    • Apply metabolic stressors that trigger disease phenotypes

    • Test potential protective effects of lemur-specific amino acid substitutions

This comparative approach may identify naturally occurring variations in Avahi cleesei that confer resistance to mitochondrial dysfunction, potentially inspiring new therapeutic strategies for human mitochondrial disorders .

How do environmental adaptations in Avahi cleesei correlate with MT-ND4L sequence and functional variations?

Avahi cleesei's adaptation to its specific forest habitat in Madagascar may have driven functional adaptations in MT-ND4L. Researchers investigating this eco-evolutionary question should:

  • Characterize the metabolic demands of Avahi cleesei's lifestyle:

    • Document activity patterns, dietary specialization, and habitat characteristics

    • Measure metabolic rates under different environmental conditions

    • Compare with closely related lemur species from different habitats

  • Identify potentially adaptive mutations in MT-ND4L:

    • Compare sequences from Avahi species across different forest types

    • Calculate selection ratios for specific amino acid positions

    • Test correlation between amino acid properties and environmental variables

  • Functional validation methodology:

    • Express MT-ND4L variants in cellular models

    • Measure Complex I activity under conditions mimicking:

      • Different temperatures

      • Varying oxygen tensions

      • Nutritional stress

    • Assess efficiency of NADH oxidation and ATP production

  • Investigate potential co-adaptations:

    • Analyze correlations between MT-ND4L variants and other mitochondrial genes

    • Examine nuclear genes involved in mitochondrial function

    • Test for mitonuclear co-adaptation experimentally

This eco-evolutionary approach connects organismal adaptation to molecular function, providing insights into how natural selection shapes critical metabolic enzymes in response to environmental pressures .

What are the most accurate methods for assessing electron transfer kinetics in recombinant Avahi cleesei MT-ND4L-containing Complex I?

Accurate measurement of electron transfer kinetics in Complex I requires sophisticated biophysical techniques. Researchers evaluating recombinant Avahi cleesei MT-ND4L should consider:

  • Spectrophotometric assays for NADH oxidation:

    • Monitor decrease in NADH absorbance at 340 nm

    • Calculate initial rates at various substrate concentrations

    • Derive kinetic parameters (Km, Vmax, kcat) for comparative analysis

    • Use various ubiquinone analogs to probe substrate specificity

  • Electrochemical approaches:

    • Develop protein film voltammetry methods for immobilized Complex I

    • Measure electron transfer rates under controlled potential

    • Determine redox potentials of electron transfer components

  • Advanced biophysical techniques:

    • Use stopped-flow spectroscopy for rapid kinetic measurements

    • Apply freeze-quench EPR to capture intermediate states

    • Implement FRET-based approaches to monitor conformational changes

  • Real-time monitoring in membrane mimetics:

    • Reconstitute Complex I into liposomes or nanodiscs

    • Monitor proton pumping using pH-sensitive fluorescent probes

    • Correlate electron transfer with proton translocation efficiency

Kinetic ParameterMeasurement TechniqueExpected Range for Wild-typeData Interpretation
NADH KmSpectrophotometric assay10-30 μMSubstrate binding affinity
kcat (NADH)Spectrophotometric assay100-300 s⁻¹Catalytic efficiency
Ubiquinone KmSpectrophotometric assay5-20 μMQuinone binding affinity
IC50 valuesInhibition assayInhibitor-dependentBinding site interactions

When comparing kinetic parameters between species variants, researchers should maintain identical experimental conditions and use appropriate statistical analyses to determine significant differences .

How can researchers accurately measure the contribution of MT-ND4L to ROS production in mitochondrial Complex I?

Reactive oxygen species (ROS) production by Complex I is physiologically significant and may vary between species. To accurately measure MT-ND4L's contribution to ROS generation, researchers should:

  • Develop reconstituted systems with defined components:

    • Express Complex I with either human or Avahi cleesei MT-ND4L

    • Ensure comparable assembly and activity of Complex I variants

    • Use purified systems to isolate MT-ND4L-specific effects

  • Employ multiple ROS detection methods:

    • Fluorescent probes (e.g., Amplex Red for H₂O₂, MitoSOX for superoxide)

    • EPR spin-trapping for superoxide quantification

    • Genetically encoded ROS sensors for real-time measurements

    • Mass spectrometry-based approaches for absolute quantification

  • Measure ROS production under physiologically relevant conditions:

    • Forward vs. reverse electron transport

    • Various substrate concentrations and ratios

    • Different oxygen tensions

    • pH and membrane potential variations

  • Assess the impact of specific amino acid substitutions:

    • Generate point mutations at divergent residues between human and Avahi cleesei

    • Measure the resulting changes in ROS production

    • Correlate structural features with ROS generation capacity

This methodological approach allows researchers to determine whether species-specific variations in MT-ND4L affect Complex I's propensity for electron leakage and consequent ROS formation, which has implications for understanding species differences in oxidative stress and aging.

What quality control measures are essential when working with recombinant MT-ND4L to ensure experimental reproducibility?

Ensuring experimental reproducibility with recombinant MT-ND4L requires rigorous quality control measures due to its hydrophobic nature and complex assembly requirements. Researchers should implement:

  • Protein quality assessment protocols:

    • SDS-PAGE and Western blotting to confirm identity and purity

    • Mass spectrometry to verify complete sequence and modifications

    • Circular dichroism to assess secondary structure

    • Size exclusion chromatography to evaluate aggregation state

  • Functional validation methods:

    • NADH:ubiquinone oxidoreductase activity assays with standardized substrates

    • Comparison to reference standards (e.g., bovine heart Complex I)

    • Assessment of inhibitor sensitivity with known Complex I inhibitors

    • Measurement of native electrophoretic mobility

  • Storage stability monitoring:

    • Define optimal buffer conditions and storage temperature

    • Implement regular activity testing during storage

    • Develop cryopreservation protocols if applicable

    • Document batch-to-batch variation with reference standards

  • Data reporting standards:

    • Document complete methodological details including expression system

    • Report protein concentration determination method

    • Include positive and negative controls in all experiments

    • Share detailed protocols through repositories like Protocols.io

By implementing these quality control measures, researchers can minimize experimental variability and increase confidence in comparative studies between Avahi cleesei and human MT-ND4L, ensuring that observed differences represent genuine biological variation rather than technical artifacts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.