Recombinant Avahi cleesei NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L) is a genetically engineered protein subunit of mitochondrial Complex I, expressed in bacterial or cell-free systems. This protein is derived from Avahi cleesei (Cleese's woolly lemur), a primate species, and serves as a research tool for studying mitochondrial electron transport, disease mechanisms, and comparative evolutionary biology.
The recombinant MT-ND4L protein from Avahi cleesei contains the sequence:
MTPIFTNIILAFATAFLGTLIFRSHLMSSLLCLEGMmLSLFILSTLIILNMHLTVSFMMP ILLLVFAACEAAIGLALLVMVSNTYGLDYIKNLNLLQC .
This sequence aligns with the core transmembrane domain of Complex I, critical for proton pumping and electron transfer.
MT-ND4L is a hydrophobic subunit embedded in the mitochondrial inner membrane, contributing to:
Electron Transfer: Facilitates the transfer of electrons from NADH to ubiquinone.
Proton Pumping: Participates in creating a proton gradient for ATP synthesis.
Structural Stability: Forms part of the transmembrane "arm" of Complex I .
The Avahi cleesei MT-ND4L variant is used to:
Investigate Mitochondrial Evolution: Compare subunit divergence across primates.
Model Human Diseases: Study mutations analogous to human MT-ND4L-associated pathologies (e.g., Leber’s Hereditary Optic Neuropathy) .
While Avahi cleesei MT-ND4L is not directly linked to human disease, its homologs in humans (e.g., Homo sapiens MT-ND4L) are implicated in:
Leber’s Hereditary Optic Neuropathy (LHON): A T10663C mutation (Val65Ala) disrupts Complex I function, leading to optic nerve degeneration .
Metabolic Disorders: Variants correlate with obesity, diabetes, and hypertension .
Recombinant MT-ND4L proteins help elucidate:
Mutation Effects: Structural or functional disruptions caused by amino acid substitutions.
Drug Targeting: Screening for compounds that restore Complex I activity in mutant models.
MT-ND4L’s role in Complex I is evolutionarily conserved, enabling cross-species comparisons to study:
MT-ND4L (mitochondrially encoded NADH dehydrogenase 4L) is a critical component of Complex I (NADH:ubiquinone oxidoreductase) embedded in the inner mitochondrial membrane. This protein participates in the first step of the electron transport process, transferring electrons from NADH to ubiquinone during oxidative phosphorylation .
To compare MT-ND4L across species, researchers should:
Perform multiple sequence alignments using tools like MUSCLE or Clustal Omega
Calculate sequence identity/similarity percentages
Identify conserved domains and variable regions
Model protein structure using homology modeling tools
Methodologically, researchers investigating structural differences should combine in silico predictions with experimental validation through techniques like circular dichroism or NMR spectroscopy when possible.
Production of functional recombinant MT-ND4L presents significant challenges due to its hydrophobic nature and mitochondrial origin. Based on research with similar mitochondrial proteins, the following expression systems have demonstrated varying degrees of success:
| Expression System | Advantages | Limitations | Optimal Conditions |
|---|---|---|---|
| E. coli BL21(DE3) | High yield, cost-effective | Inclusion body formation common | Fusion with solubility tags (MBP, SUMO); low induction temperature (16-18°C) |
| Insect cells (Sf9, Hi5) | Better folding of membrane proteins | Higher cost, longer production time | Baculovirus expression with C-terminal purification tag |
| Mammalian cells (HEK293, CHO) | Native-like post-translational modifications | Lowest yield, highest cost | Inducible expression systems; supplemented media |
Methodological approach should include:
Codon optimization for the chosen expression host
Inclusion of purification tags (His6, FLAG) that can be later removed
Careful consideration of detergents for membrane protein solubilization
Validation of protein folding and function after purification
When establishing expression protocols, researchers should monitor both expression levels and functional integrity through activity assays specific to Complex I .
Verifying functional activity of recombinant MT-ND4L requires assessing its ability to integrate into Complex I and contribute to electron transport. Researchers can employ the following methodological approaches:
NADH:ubiquinone oxidoreductase activity assay: Measure the rate of NADH oxidation spectrophotometrically at 340 nm in the presence of ubiquinone analogues. This can be conducted using purified recombinant protein reconstituted into liposomes or mitochondrial fractions .
Complementation studies: Express recombinant MT-ND4L in cell lines with MT-ND4L deficiency or mutations and assess restoration of Complex I activity.
Blue Native PAGE: Analyze proper integration into the Complex I assembly through gel electrophoresis combined with Western blotting.
Oxygen consumption measurements: Using oxygen electrodes to measure respiration rates in reconstituted systems or complemented cells.
For accurate functional assessment, researchers should include positive controls (wild-type human MT-ND4L) and negative controls (known non-functional mutants) in experimental designs.
Species-specific differences in MT-ND4L function likely result from evolutionary adaptations related to metabolic requirements and environmental pressures. To investigate these differences systematically, researchers should:
Conduct comprehensive phylogenetic analyses comparing MT-ND4L sequences across primate species, with particular attention to:
Non-synonymous versus synonymous substitution rates (dN/dS) to identify sites under selection
Mapping amino acid substitutions onto structural models
Correlation of substitutions with ecological and physiological adaptations
Develop chimeric proteins containing domains from different species to identify regions responsible for functional differences.
Perform site-directed mutagenesis to test the functional impact of specific amino acid substitutions.
Measure kinetic parameters (Km, Vmax) for electron transfer from NADH to ubiquinone for MT-ND4L from different species.
Advanced computational methods including molecular dynamics simulations can provide insights into how amino acid substitutions affect protein dynamics and interactions within Complex I. These simulations should be conducted over sufficient timescales (>100 ns) and validated experimentally when possible .
Understanding differential inhibitor interactions between species variants of MT-ND4L has significant implications for evolutionary biology and potential therapeutic development. Researchers investigating this question should employ a multi-faceted approach:
Comparative inhibition studies: Test a panel of known Complex I inhibitors (including benzopyrans and other classes) against recombinant Complex I containing either Avahi cleesei or human MT-ND4L. Determine IC50 values and inhibition kinetics for each compound .
Binding site analysis: Use photoaffinity labeling with derivatized inhibitors to identify specific binding residues.
Resistance profile characterization: Generate point mutations in conserved residues to identify those critical for inhibitor binding.
| Inhibitor Class | Example Compounds | Typical Human IC50 Range | Expected Experimental Approach |
|---|---|---|---|
| Benzopyrans | 2,2-dimethylbenzopyran derivatives | 18-55 nM | Spectrophotometric NADH oxidation assays |
| Rotenoids | Rotenone, deguelin | 1-20 nM | Oxygen consumption measurements |
| Acetogenins | Annonacin, bullatacin | 5-50 nM | Cell-based viability assays with isolated mitochondria |
The collected data should be analyzed to identify pharmacophore features that interact differently with Avahi cleesei MT-ND4L compared to human MT-ND4L. This information can provide evolutionary insights and potentially guide the development of species-specific Complex I modulators .
Identify natural PTMs in native MT-ND4L:
Isolate mitochondria from Avahi cleesei tissue samples (if available)
Perform mass spectrometry analysis to identify PTMs (phosphorylation, acetylation, etc.)
Compare PTM patterns between different primate species
Develop expression systems that preserve relevant PTMs:
For phosphorylation: Use mammalian expression systems with relevant kinases
For acetylation: Co-express with appropriate acetyltransferases
Consider cell-free systems supplemented with mitochondrial extracts
Evaluate functional consequences of specific PTMs:
Generate site-directed mutants that mimic or prevent specific PTMs
Assess effects on Complex I assembly, stability, and activity
Investigate potential regulatory roles under different metabolic conditions
When addressing this question experimentally, researchers should be aware that the mitochondrial environment differs from cytosolic conditions, and expression systems may need modification to accurately recapitulate the native state of MT-ND4L.
Mutations in human MT-ND4L have been associated with mitochondrial disorders such as Leber hereditary optic neuropathy (LHON) . Comparative analysis of Avahi cleesei MT-ND4L can provide evolutionary context for understanding pathogenic mutations. Researchers should:
Catalog natural sequence variations:
Compare MT-ND4L sequences across lemur species, including Avahi cleesei
Identify positions where human pathogenic mutations occur in the lemur sequence
Determine if lemurs possess compensatory mutations that mitigate potential pathogenic effects
Develop functional assays for mutation impact:
Express recombinant MT-ND4L containing specific mutations found in LHON patients
Measure effects on Complex I assembly, stability, and activity
Assess ROS production and mitochondrial membrane potential in cellular models
Create lemur-human chimeric proteins to test functional domains:
Replace human MT-ND4L segments with corresponding Avahi cleesei segments
Test if lemur sequences can rescue function of pathogenic human mutations
Identify potentially protective elements in the lemur sequence
This research approach can potentially identify natural variants in Avahi cleesei that might confer resistance to mutation effects seen in human mitochondrial disorders, providing new avenues for therapeutic development .
Isolating native MT-ND4L from tissue samples presents significant challenges due to its hydrophobic nature and integration within Complex I. Researchers working with limited Avahi cleesei samples should consider the following optimized protocol:
Tissue preservation and preparation:
Flash-freeze tissue samples immediately in liquid nitrogen
Store at -80°C with protease inhibitors and antioxidants
Homogenize using gentle mechanical disruption in isotonic buffer
Mitochondrial isolation:
Perform differential centrifugation (600g → 7,000g → 10,000g)
Purify mitochondria using Percoll gradient centrifugation
Verify mitochondrial integrity through citrate synthase activity assay
Complex I extraction and MT-ND4L isolation:
Solubilize mitochondrial membranes with mild detergents (DDM or digitonin)
Isolate Complex I through blue native PAGE or immunoprecipitation
Extract MT-ND4L using specialized detergent mixtures or organic solvents
Verification methods:
Western blotting with antibodies against conserved MT-ND4L epitopes
Mass spectrometry for protein identification and characterization
N-terminal sequencing to confirm protein identity
When working with endangered species like Avahi cleesei, researchers should maximize data collection from minimal sample amounts and consider non-invasive alternatives when possible, such as using cultured cells derived from small tissue biopsies.
Developing antibodies that effectively recognize Avahi cleesei MT-ND4L while maintaining specificity presents unique challenges. Researchers should employ the following methodological approach:
Epitope selection strategy:
Perform multiple sequence alignments of MT-ND4L across primates
Identify conserved regions between humans and lemurs
Select epitopes with:
High antigenicity scores
Surface accessibility in protein models
Minimal post-translational modification sites
Antibody development approach:
Consider developing monoclonal antibodies against synthesized peptides
Test both N-terminal and C-terminal directed antibodies
Validate with both recombinant protein and native samples when available
Validation protocol:
Test against recombinant Avahi cleesei MT-ND4L
Confirm specificity using Western blotting against mitochondrial fractions
Perform immunoprecipitation to verify protein-antibody interaction
Validate cross-reactivity with other primate species to determine specificity
Application optimization:
Determine optimal antibody concentration for each application
Test fixation conditions for immunohistochemistry applications
Optimize blocking conditions to minimize background
The most successful approach typically involves targeting highly conserved epitopes while carefully validating specificity against multiple species controls to ensure reliable detection of Avahi cleesei MT-ND4L.
Predicting protein-protein interactions within Complex I requires sophisticated computational approaches. For studying MT-ND4L interactions, researchers should consider these methodological steps:
Homology modeling and structural prediction:
Generate a model of Avahi cleesei MT-ND4L based on known structures
Refine the model using molecular dynamics simulations
Validate model quality using metrics like RMSD, Ramachandran plots, and QMEAN scores
Protein-protein docking approaches:
Rigid body docking using tools like ZDOCK or ClusPro
Flexible docking with HADDOCK or RosettaDock
Energy minimization of docked complexes
Interaction hotspot prediction:
Use computational alanine scanning to identify key residues
Calculate binding free energies using MM/PBSA methods
Identify conserved interaction interfaces across species
Validation through experimental approaches:
Cross-linking coupled with mass spectrometry
FRET or PLA assays to confirm predicted interactions
Mutagenesis of predicted interface residues
| Computational Method | Strengths | Limitations | Best Application |
|---|---|---|---|
| Homology modeling | Works well for conserved proteins | Accuracy depends on template quality | Initial structure prediction |
| Molecular dynamics | Captures protein flexibility | Computationally intensive | Refinement and stability assessment |
| Molecular docking | Predicts binding modes | May miss dynamic interactions | Initial interaction screening |
| MM/PBSA calculations | Provides binding energetics | Requires accurate structures | Quantifying interaction strength |
For MT-ND4L specifically, researchers should pay special attention to the hydrophobic transmembrane regions that are critical for assembly within Complex I but challenging to model accurately .
MT-ND4L evolution among lemur species provides insights into mitochondrial adaptation to different ecological niches. Researchers investigating this question should:
Conduct comprehensive phylogenetic analysis:
Correlate sequence variations with ecological factors:
Assess functional consequences of species-specific variations:
Express recombinant MT-ND4L from different lemur species
Compare enzymatic properties and stability characteristics
Evaluate performance under conditions mimicking different habitats
Investigate coevolution with nuclear-encoded Complex I subunits:
Analyze compensatory mutations between mitochondrial and nuclear genomes
Identify potential mismatches that might contribute to hybrid incompatibility
Test nuclear-mitochondrial interactions experimentally
This evolutionary perspective can provide valuable insights into how mitochondrial function adapts to different environmental pressures and contributes to speciation events among lemurs .
Comparative analysis between Avahi cleesei and human MT-ND4L offers a unique evolutionary perspective on mitochondrial disorders. Researchers should:
Map human pathogenic mutations onto the Avahi cleesei sequence:
Functional comparison methodology:
Express both wild-type and mutant forms of human and Avahi cleesei MT-ND4L
Measure impact on:
Complex I assembly and stability
NADH:ubiquinone oxidoreductase activity
ROS production
ATP synthesis
Investigate tissue-specific effects:
Develop experimental disease models:
Generate cell lines with "humanized" or "lemurized" MT-ND4L
Apply metabolic stressors that trigger disease phenotypes
Test potential protective effects of lemur-specific amino acid substitutions
This comparative approach may identify naturally occurring variations in Avahi cleesei that confer resistance to mitochondrial dysfunction, potentially inspiring new therapeutic strategies for human mitochondrial disorders .
Avahi cleesei's adaptation to its specific forest habitat in Madagascar may have driven functional adaptations in MT-ND4L. Researchers investigating this eco-evolutionary question should:
Characterize the metabolic demands of Avahi cleesei's lifestyle:
Document activity patterns, dietary specialization, and habitat characteristics
Measure metabolic rates under different environmental conditions
Compare with closely related lemur species from different habitats
Identify potentially adaptive mutations in MT-ND4L:
Compare sequences from Avahi species across different forest types
Calculate selection ratios for specific amino acid positions
Test correlation between amino acid properties and environmental variables
Functional validation methodology:
Express MT-ND4L variants in cellular models
Measure Complex I activity under conditions mimicking:
Different temperatures
Varying oxygen tensions
Nutritional stress
Assess efficiency of NADH oxidation and ATP production
Investigate potential co-adaptations:
Analyze correlations between MT-ND4L variants and other mitochondrial genes
Examine nuclear genes involved in mitochondrial function
Test for mitonuclear co-adaptation experimentally
This eco-evolutionary approach connects organismal adaptation to molecular function, providing insights into how natural selection shapes critical metabolic enzymes in response to environmental pressures .
Accurate measurement of electron transfer kinetics in Complex I requires sophisticated biophysical techniques. Researchers evaluating recombinant Avahi cleesei MT-ND4L should consider:
Spectrophotometric assays for NADH oxidation:
Electrochemical approaches:
Develop protein film voltammetry methods for immobilized Complex I
Measure electron transfer rates under controlled potential
Determine redox potentials of electron transfer components
Advanced biophysical techniques:
Use stopped-flow spectroscopy for rapid kinetic measurements
Apply freeze-quench EPR to capture intermediate states
Implement FRET-based approaches to monitor conformational changes
Real-time monitoring in membrane mimetics:
Reconstitute Complex I into liposomes or nanodiscs
Monitor proton pumping using pH-sensitive fluorescent probes
Correlate electron transfer with proton translocation efficiency
| Kinetic Parameter | Measurement Technique | Expected Range for Wild-type | Data Interpretation |
|---|---|---|---|
| NADH Km | Spectrophotometric assay | 10-30 μM | Substrate binding affinity |
| kcat (NADH) | Spectrophotometric assay | 100-300 s⁻¹ | Catalytic efficiency |
| Ubiquinone Km | Spectrophotometric assay | 5-20 μM | Quinone binding affinity |
| IC50 values | Inhibition assay | Inhibitor-dependent | Binding site interactions |
When comparing kinetic parameters between species variants, researchers should maintain identical experimental conditions and use appropriate statistical analyses to determine significant differences .
Reactive oxygen species (ROS) production by Complex I is physiologically significant and may vary between species. To accurately measure MT-ND4L's contribution to ROS generation, researchers should:
Develop reconstituted systems with defined components:
Express Complex I with either human or Avahi cleesei MT-ND4L
Ensure comparable assembly and activity of Complex I variants
Use purified systems to isolate MT-ND4L-specific effects
Employ multiple ROS detection methods:
Fluorescent probes (e.g., Amplex Red for H₂O₂, MitoSOX for superoxide)
EPR spin-trapping for superoxide quantification
Genetically encoded ROS sensors for real-time measurements
Mass spectrometry-based approaches for absolute quantification
Measure ROS production under physiologically relevant conditions:
Forward vs. reverse electron transport
Various substrate concentrations and ratios
Different oxygen tensions
pH and membrane potential variations
Assess the impact of specific amino acid substitutions:
Generate point mutations at divergent residues between human and Avahi cleesei
Measure the resulting changes in ROS production
Correlate structural features with ROS generation capacity
This methodological approach allows researchers to determine whether species-specific variations in MT-ND4L affect Complex I's propensity for electron leakage and consequent ROS formation, which has implications for understanding species differences in oxidative stress and aging.
Ensuring experimental reproducibility with recombinant MT-ND4L requires rigorous quality control measures due to its hydrophobic nature and complex assembly requirements. Researchers should implement:
Protein quality assessment protocols:
SDS-PAGE and Western blotting to confirm identity and purity
Mass spectrometry to verify complete sequence and modifications
Circular dichroism to assess secondary structure
Size exclusion chromatography to evaluate aggregation state
Functional validation methods:
Storage stability monitoring:
Define optimal buffer conditions and storage temperature
Implement regular activity testing during storage
Develop cryopreservation protocols if applicable
Document batch-to-batch variation with reference standards
Data reporting standards:
Document complete methodological details including expression system
Report protein concentration determination method
Include positive and negative controls in all experiments
Share detailed protocols through repositories like Protocols.io
By implementing these quality control measures, researchers can minimize experimental variability and increase confidence in comparative studies between Avahi cleesei and human MT-ND4L, ensuring that observed differences represent genuine biological variation rather than technical artifacts.