Recombinant Avahi laniger NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Overview of MT-ND4L and Its Recombinant Form

MT-ND4L encodes a 98-amino-acid subunit of Complex I (NADH dehydrogenase) in the mitochondrial electron transport chain. It facilitates electron transfer from NADH to ubiquinone, essential for ATP synthesis . The recombinant version from Avahi laniger is a full-length protein (1–98aa) fused with an N-terminal His-tag, enabling efficient purification via affinity chromatography .

PropertyValue
SourceAvahi laniger (Sambirano woolly lemur)
Expression SystemE. coli
TagN-terminal His-tag
Protein LengthFull-length (1–98aa)
Purity>90% (SDS-PAGE)
FormLyophilized powder
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
Storage Conditions-20°C/-80°C (avoid freeze-thaw cycles)

Key Features:

  • Hydrophobicity: Forms the core of Complex I’s transmembrane region .

  • Redox Activity: Participates in electron transfer via iron-sulfur clusters .

  • Gene Overlap: Shares three codons with MT-ND4 in humans, ensuring coordinated transcription .

Clinical and Research Significance

MT-ND4L mutations are linked to Leber’s Hereditary Optic Neuropathy (LHON) in humans, particularly the T10663C mutation causing valine-to-alanine substitution . While Avahi laniger’s recombinant MT-ND4L is not directly implicated in human disease, it serves as a model for studying Complex I dysfunction and mitochondrial disorders.

Potential Applications:

  • Structural Biology: Probing conformational dynamics of Complex I using cryo-EM or X-ray crystallography .

  • Therapeutic Targeting: Identifying small-molecule modulators to restore Complex I activity in LHON models .

  • Evolutionary Studies: Comparing mitochondrial gene evolution across primates .

Challenges and Limitations

  • Limited Data: Few studies explicitly focus on Avahi laniger’s MT-ND4L; most research uses human or rodent models .

  • Species-Specific Variations: Structural differences between lemur and human MT-ND4L may affect functional outcomes .

  • Storage Sensitivity: Requires strict handling to prevent degradation .

References and Further Reading

  1. Creative Biomart (2025). Recombinant Full Length Avahi unicolor NADH-Ubiquinone Oxidoreductase Chain 4L.

  2. Wikipedia (2007). MT-ND4L.

  3. Receptor.AI (2024). NADH-Ubiquinone Oxidoreductase Chain 4L.

  4. Creative Biomart (2025). Recombinant Full Length Human NADH-Ubiquinone Oxidoreductase Chain 4L.

  5. ChemicalBook (2019). Recombinant Avahi laniger NADH-Ubiquinone Oxidoreductase Chain 4L.

  6. MedlinePlus Genetics (2021). MT-ND4L Gene.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life of the product is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms can be stored for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Avahi laniger (Eastern woolly lemur)
Target Names
Target Protein Sequence
MPSIFTNIILAFATALLGTLVFRSHLMSSLLCLEGMMLSLFTLSTLIILNMHLTMSFMMP ILLLVFAACEAAIGLALLVMVSNTYGLDYIKNLSLLQC
Uniprot No.

Target Background

Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the basic function of MT-ND4L in mitochondrial systems?

MT-ND4L (mitochondrially encoded NADH dehydrogenase 4L) functions as an essential component of the mitochondrial respiratory chain Complex I. This protein participates in the first step of the electron transport process, facilitating electron transfer from NADH to ubiquinone. The protein is embedded within the inner mitochondrial membrane where it contributes to establishing the electrochemical gradient necessary for ATP production through oxidative phosphorylation . The protein's role is critical for energy metabolism in eukaryotic cells, as it helps create the unequal electrical charge across the inner mitochondrial membrane that drives ATP synthesis .

How does Avahi laniger MT-ND4L differ structurally from human MT-ND4L?

Avahi laniger, a nocturnal prosimian from Madagascar's eastern rainforests, possesses specific adaptations in its mitochondrial proteins that reflect its unique evolutionary history and metabolic requirements. While complete structural comparisons between Avahi laniger and human MT-ND4L require detailed protein analysis, research suggests several key differences likely exist in amino acid composition that may relate to the lemur's specialized leaf-based diet and nocturnal lifestyle . These adaptations potentially enable more efficient energy extraction from a low-quality food source, as Avahi laniger spends approximately 65% of its night resting or grooming, with feeding occupying only about 22% of its activity budget—a pattern suggesting specialized metabolic adaptations .

What expression systems are most suitable for producing recombinant Avahi laniger MT-ND4L?

For recombinant production of Avahi laniger MT-ND4L, researchers should consider expression systems that can accommodate the challenges of membrane protein expression. Based on established protocols for similar mitochondrial proteins, recommended expression systems include:

  • Bacterial systems (E. coli): While cost-effective, these may require optimization with fusion tags to improve solubility and prevent aggregation of the hydrophobic MT-ND4L protein.

  • Yeast expression systems: Particularly Pichia pastoris, which offers proper folding of mitochondrial proteins with eukaryotic post-translational modifications.

  • Mammalian cell lines: These provide the most native-like environment for folding and assembly but at higher cost and lower yield than microbial systems.

The selection should be guided by downstream applications, with consideration for whether functional activity or structural studies are the primary goal .

What purification strategies optimize yield and stability of recombinant Avahi laniger MT-ND4L?

Purification of recombinant Avahi laniger MT-ND4L presents significant challenges due to its highly hydrophobic nature and tendency to aggregate. A multi-step purification strategy is recommended:

  • Detergent screening phase: Test a panel of detergents (DDM, LMNG, digitonin) at varying concentrations to identify optimal solubilization conditions.

  • Affinity chromatography: Utilize His-tag or other fusion tags for initial capture, with careful optimization of imidazole gradients to minimize non-specific binding.

  • Size exclusion chromatography: Critical for separating monomeric protein from aggregates and removing detergent micelles.

  • Stabilization buffer optimization: Maintain protein stability through buffer screening incorporating:

    • pH ranges (6.5-8.0)

    • Salt concentrations (100-500 mM NaCl)

    • Glycerol (5-10%)

    • Specific lipids that mimic the mitochondrial inner membrane

This approach, incorporating principles from AI-driven conformational ensemble analysis, enables researchers to identify conditions that maintain the native fold of this challenging membrane protein .

How can researchers effectively validate the proper folding and functionality of recombinant MT-ND4L?

Validating proper folding and functionality of recombinant MT-ND4L requires a multi-faceted approach:

  • Biophysical characterization:

    • Circular dichroism (CD) spectroscopy to assess secondary structure elements

    • Thermal shift assays to evaluate protein stability

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to confirm oligomeric state

  • Functional assays:

    • NADH oxidation activity measurements

    • Ubiquinone reduction assays

    • Reconstitution into proteoliposomes to assess membrane integration

  • Structural validation:

    • Limited proteolysis to confirm proper folding

    • Binding assays with known Complex I interaction partners

Researchers should compare results to human MT-ND4L controls to identify species-specific characteristics while ensuring the protein maintains its native conformation and enzymatic capacity .

What techniques are most effective for studying MT-ND4L interactions with other Complex I subunits?

Studying MT-ND4L interactions with other Complex I subunits requires specialized techniques that can capture both stable and transient protein-protein interactions:

Table 1: Comparative Analysis of Techniques for Studying MT-ND4L Protein Interactions

TechniqueResolutionAdvantagesLimitationsBest Application
Co-immunoprecipitationLowIdentifies stable interactionsDisrupts membrane environmentInitial interaction screening
Crosslinking Mass SpectrometryMediumMaps interaction interfacesPotential artifactsIdentifying contact points
FRET/BRETMediumReal-time monitoring in living cellsRequires fluorescent tagsDynamic interaction studies
Cryo-EMHighNear-atomic resolution of entire complexRequires stable, purified complexStructural determination
Hydrogen-Deuterium Exchange MSMedium-HighMaps protein dynamics and interfacesComplex data analysisConformational changes upon binding

When studying the specific interactions of Avahi laniger MT-ND4L within Complex I, researchers should employ complementary approaches, starting with crosslinking studies followed by validation through more targeted techniques like proximity labeling or hydrogen-deuterium exchange mass spectrometry .

How can Avahi laniger MT-ND4L be utilized to study evolutionary adaptations in mitochondrial function?

Avahi laniger MT-ND4L represents a valuable model for studying evolutionary adaptations in mitochondrial function, particularly in the context of specialized metabolic requirements. Research approaches should include:

  • Comparative genomics analysis: Align MT-ND4L sequences across primate species to identify conserved regions versus Avahi-specific adaptations, focusing on sites under positive selection.

  • Functional studies of site-directed mutants: Generate chimeric proteins with human/lemur substitutions at key positions to identify residues responsible for specialized functions.

  • Metabolic flux analysis: Compare energy efficiency parameters between recombinant human and Avahi laniger MT-ND4L when incorporated into nanodiscs or proteoliposomes.

  • Environmental adaptation correlations: Analyze how specific amino acid changes correlate with the lemur's folivorous diet and energy conservation requirements. Avahi laniger's leaf-only diet and extended resting periods (59.5% of nighttime) suggest specialized metabolic adaptations that may be reflected in MT-ND4L structure and function .

This research direction helps elucidate how mitochondrial complexes adapt to different ecological niches and metabolic demands through evolutionary time .

What are the challenges in characterizing the role of MT-ND4L mutations in mitochondrial disorders?

Investigating MT-ND4L mutations presents significant challenges that require sophisticated methodological approaches:

  • Heteroplasmy quantification: Mitochondrial mutations typically exist in mixed populations within cells. Researchers must employ digital droplet PCR or next-generation sequencing to precisely quantify mutation loads.

  • Tissue-specific effects: MT-ND4L mutations may manifest differently across tissues based on energy demands. Experimental designs should incorporate multiple cell types derived from iPSCs to capture tissue-specific phenotypes.

  • Functional assessment complexities: Distinguishing pathogenic from benign variants requires:

    • Cybrid cell technology to isolate mitochondrial effects

    • Oxygen consumption rate measurements

    • ROS production quantification

    • Membrane potential assessments

  • Model system limitations: Avahi laniger MT-ND4L studies must account for species-specific differences when extrapolating to human disease. The known T10663C (Val65Ala) mutation in human MT-ND4L associated with Leber hereditary optic neuropathy provides a comparative framework for understanding mutation impacts .

Researchers should employ AI-driven predictive modeling as demonstrated by Receptor.AI's conformational ensemble analysis to predict structural impacts of mutations before experimental validation .

How can molecular dynamics simulations enhance understanding of MT-ND4L function?

Molecular dynamics simulations offer powerful insights into MT-ND4L function at the atomic level:

  • Conformational flexibility mapping: AI-enhanced simulations can explore the conformational landscape of MT-ND4L, identifying regions of flexibility important for catalytic function.

  • Lipid-protein interaction analysis: Simulations in a realistic membrane environment reveal how specific lipids may modulate protein function and stability.

  • Proton translocation mechanisms: Quantum mechanics/molecular mechanics (QM/MM) simulations can elucidate the precise mechanism of proton movement through the protein during the catalytic cycle.

  • Binding pocket characterization: AI-based pocket prediction algorithms identify potential orthosteric and allosteric sites that might be targeted for therapeutic development.

The Receptor.AI platform demonstrates how advanced AI algorithms can predict alternative functional states of proteins like NADH-ubiquinone oxidoreductase chain 4L, generating statistically robust ensembles of conformations that capture the receptor's full dynamic behavior . These simulation approaches provide atomic-level insights impossible to obtain through experimental methods alone.

How do dietary adaptations in Avahi laniger correlate with MT-ND4L structure and function?

The dietary specialization of Avahi laniger provides a unique lens through which to study mitochondrial adaptations. Research indicates this nocturnal lemur consumes an exclusively leaf-based diet, with observational studies confirming leaf-only consumption and fecal analysis showing no evidence of fruits, flowers, or insects . This highly specialized folivorous diet correlates with:

  • Energy conservation behaviors: Avahi laniger spends 59.5% of its night resting and only 22% feeding, suggesting adaptations for extracting maximal energy from low-quality food .

  • Potential enzymatic adaptations: The MT-ND4L protein may exhibit specialized structural features that optimize electron transport efficiency under dietary constraints.

  • Oxidative stress management: Folivorous diets can generate specific patterns of oxidative stress, potentially driving adaptations in Complex I that could be mapped to specific residues in MT-ND4L.

Researchers should design comparative experiments using recombinant MT-ND4L from Avahi laniger alongside proteins from omnivorous primates to identify specific adaptations that facilitate energy extraction from this challenging diet .

What methods best characterize post-translational modifications of Avahi laniger MT-ND4L?

Post-translational modifications (PTMs) of MT-ND4L likely play crucial roles in regulating its function. The recommended multi-tiered analytical approach includes:

  • Sample preparation optimization:

    • Enrichment strategies specific to each PTM type (phosphorylation, acetylation, etc.)

    • Gentle solubilization protocols to maintain intact modifications

    • Targeted proteolytic digestion strategies

  • Analytical techniques hierarchy:

    • Initial screening via high-resolution LC-MS/MS with electron transfer dissociation

    • Site-specific characterization using targeted parallel reaction monitoring

    • Quantitative analysis through SILAC or TMT labeling

    • Validation with modification-specific antibodies (when available)

  • Functional correlation:

    • Site-directed mutagenesis of modified residues

    • Activity assays comparing wild-type and modification-mimetic mutants

    • Temporal dynamics analysis during different metabolic states

This comprehensive approach enables researchers to map the "PTM landscape" of Avahi laniger MT-ND4L and compare it with other species to identify conserved regulatory mechanisms and species-specific adaptations .

How can cryo-electron microscopy be optimized for structural studies of recombinant MT-ND4L?

Cryo-electron microscopy (cryo-EM) offers tremendous potential for structural characterization of MT-ND4L but requires specialized approaches:

  • Sample preparation optimization:

    • Detergent screening to identify conditions that maintain native protein conformation while allowing for thin ice formation

    • Reconstitution into nanodiscs or amphipols to better mimic the native membrane environment

    • Optimization of protein concentration to balance between particle density and aggregation

  • Data collection parameters:

    • Energy filter optimization to enhance contrast of this relatively small protein

    • Motion correction protocols specific to membrane proteins

    • Dose fractionation strategies that account for radiation sensitivity

  • Image processing considerations:

    • Classifications strategies to separate different conformational states

    • 3D variance analysis to identify regions of flexibility

    • Local resolution refinement focusing on the core structural elements

Researchers should consider complementing cryo-EM with AI-driven structural prediction approaches, as demonstrated by Receptor.AI's conformational ensemble generation technology, which can provide additional structural insights, particularly for regions with high flexibility .

What potential exists for using Avahi laniger MT-ND4L as a model for studying mitochondrial disorders?

Avahi laniger MT-ND4L offers unique advantages as a model system for studying mitochondrial disorders for several reasons:

  • Evolutionary insights: As a prosimian species with specialized metabolic adaptations, comparative analysis between human and Avahi laniger MT-ND4L can highlight functionally critical regions versus adaptable sections of the protein.

  • Natural stress resistance: The lemur's adaptations to a low-energy diet may confer resistance mechanisms against oxidative stress that could inform therapeutic strategies for mitochondrial disorders.

  • Mutation impact prediction: Known human pathogenic mutations, such as the T10663C (Val65Ala) variant associated with Leber hereditary optic neuropathy, can be studied in the context of the Avahi protein to understand compensatory mechanisms .

  • Therapeutic target identification: Comparing binding pocket structures between species using AI-powered algorithms similar to those employed by Receptor.AI could reveal novel allosteric sites for drug development .

Future research should establish cell lines expressing Avahi laniger MT-ND4L variants to enable high-throughput screening of compounds that might stabilize mutant proteins or enhance their assembly into functional Complex I.

How can integrative structural biology approaches advance understanding of MT-ND4L?

An integrative structural biology approach combines multiple experimental and computational techniques to develop a comprehensive understanding of MT-ND4L structure and function:

Table 2: Integrative Structural Biology Framework for MT-ND4L Research

This integrated approach, incorporating AI-driven conformational ensemble generation techniques like those used by Receptor.AI, enables researchers to develop complete structural models that capture both static architecture and dynamic behavior of the protein . The resulting models can inform structure-based drug design and provide mechanistic insights into Complex I function and dysfunction.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.