Recombinant Avahi unicolor NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Molecular Definition and Biological Role

Recombinant Avahi unicolor MT-ND4L is a 98-amino acid protein (UniProt ID: A8DQI8) expressed with an N-terminal His tag in E. coli systems . It corresponds to the full-length NADH-ubiquinone oxidoreductase chain 4L, a core subunit of mitochondrial Complex I (NADH dehydrogenase), which catalyzes electron transfer from NADH to ubiquinone during oxidative phosphorylation .

Key functional attributes:

  • Essential for structural integrity and catalytic activity of Complex I .

  • Participates in proton gradient generation across the mitochondrial inner membrane, driving ATP synthesis .

  • Loss of ND4L disrupts Complex I assembly, as demonstrated in Chlamydomonas reinhardtii RNAi studies .

Disease Modeling

  • Mutations in human MT-ND4L are linked to Leber hereditary optic neuropathy and MELAS syndrome . Recombinant Avahi ND4L enables comparative studies to dissect pathogenic mechanisms .

  • Used to investigate Complex I deficiencies in neurodegenerative disorders like Alzheimer’s disease .

Enzymatic Studies

  • Functional assays confirm its role in electron transfer kinetics and ubiquinone reduction .

  • Structural homology modeling with human ND4L supports drug discovery for mitochondrial disorders .

Comparative Analysis with Orthologs

The Avahi unicolor ND4L shares evolutionary conservation with human and model organism variants:

SpeciesGene LocationRole in Complex I AssemblyKey References
Avahi unicolorMitochondrialCore subunit stability
Homo sapiensMitochondrialPathogenic mutation hotspot
Chlamydomonas reinhardtiiNuclearRNAi knockdown disrupts Complex I

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and protein stability. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have specific tag requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Avahi unicolor (Sambirano woolly lemur)
Target Names
Target Protein Sequence
MPPIFANIILAFATAFLGTLIFRSHLMSSLLCLEGMMLSMFILSTLIILNMHLTVSFMMP ILLLVFAACEAAIGLALLVMVSNTYGLDYIKNLNLLQC
Uniprot No.

Target Background

Function
The protein, Avahi unicolor NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L), is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). This enzyme catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor.
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND4L and what is its function in mitochondrial biology?

MT-ND4L (mitochondrially encoded NADH dehydrogenase 4L) is a protein-coding gene located in the mitochondrial genome that encodes a critical subunit of Complex I (NADH-ubiquinone oxidoreductase) of the respiratory chain. It enables NADH dehydrogenase (ubiquinone) activity and is involved in mitochondrial electron transport from NADH to ubiquinone, contributing to the proton motive force that drives ATP synthesis . Located in the mitochondrial inner membrane, MT-ND4L plays an essential role in cellular energy production through oxidative phosphorylation . Despite its small size, this protein is critical for maintaining the structural integrity and function of Complex I.

Where is the MT-ND4L gene located in the mitochondrial genome and what is its structure?

The MT-ND4L gene is located on the mitochondrial chromosome at position 10470 to 10766 on the reference sequence NC_012920.1 . This relatively small gene spans approximately 297 base pairs and encodes a protein of 98 amino acids. The gene is entirely protein-coding without introns, characteristic of mitochondrial genes. Multiple computational models have been developed to predict its three-dimensional structure, including those available in databases like the RCSB PDB (Protein Data Bank) . These models suggest MT-ND4L contains multiple transmembrane domains that anchor it within the inner mitochondrial membrane.

How conserved is MT-ND4L across primate species and what can this tell us about its evolutionary significance?

MT-ND4L shows varying degrees of conservation across species, with significant conservation in functionally critical regions. Research on high-altitude adaptation in Tibetan yaks and cattle has demonstrated that specific MT-ND4L haplotypes (particularly haplotype Ha1) show positive associations with high-altitude adaptability . This suggests that certain MT-ND4L variants may confer evolutionary advantages in specific environmental conditions. For a comprehensive evolutionary analysis, researchers should:

  • Perform multiple sequence alignments of MT-ND4L across diverse primate species

  • Calculate conservation scores for each amino acid position

  • Identify regions under positive or purifying selection

  • Correlate sequence variations with ecological adaptations

What expression systems are optimal for producing recombinant Avahi unicolor MT-ND4L?

Producing functional recombinant MT-ND4L presents significant challenges due to its hydrophobicity and mitochondrial origin. Researchers should consider these methodological approaches:

Expression SystemAdvantagesDisadvantagesOptimization Strategies
E. coli (C41/C43 strains)High yield, cost-effectiveMay form inclusion bodiesUse fusion tags (MBP, SUMO); lower induction temperature (16-20°C)
Yeast (P. pastoris)Proper protein folding, post-translational modificationsModerate yieldOptimize codon usage; use inducible promoters
Mammalian cellsNative-like folding and modificationsLower yield, expensiveUse specialized vectors with mitochondrial targeting sequences
Cell-free systemsAvoids toxicity issuesLimited scaleSupplement with chaperones and membrane mimetics

For optimal results, expression constructs should include: 1) an N-terminal purification tag (His6 or Strep-tag II), 2) a protease cleavage site, and 3) codon optimization for the chosen expression system.

What purification strategies are most effective for recombinant MT-ND4L?

Purifying hydrophobic membrane proteins like MT-ND4L requires specialized approaches that maintain protein stability and native conformation. An effective purification strategy would include:

  • Membrane solubilization using mild detergents (n-dodecyl-β-D-maltoside or digitonin)

  • Affinity chromatography utilizing the attached purification tag

  • Size exclusion chromatography to separate monomeric protein from aggregates

  • Validation by Western blotting, mass spectrometry, and activity assays

Throughout purification, it is critical to monitor protein stability and maintain appropriate detergent concentrations to prevent aggregation or denaturation.

How can researchers assess the functional activity of purified recombinant MT-ND4L?

Assessing the functional activity of recombinant MT-ND4L involves multiple complementary approaches:

  • Integration assays to determine proper incorporation into Complex I, using blue native PAGE with in-gel activity staining

  • NADH:ubiquinone oxidoreductase activity assays measuring the rate of NADH oxidation spectrophotometrically

  • Proton pumping assays using pH-sensitive fluorescent dyes in reconstituted proteoliposomes

  • Structural integrity assessment using circular dichroism or limited proteolysis

The combination of these methods provides comprehensive evaluation of whether the recombinant protein maintains native-like functional characteristics.

How do mutations in MT-ND4L affect Complex I assembly and function in mitochondrial disease?

Mutations in MT-ND4L can significantly impact Complex I assembly and function, contributing to mitochondrial diseases such as Leber hereditary optic neuropathy . When studying these effects, researchers should:

  • Create site-directed mutants corresponding to disease-associated variants

  • Assess Complex I assembly using blue native gel electrophoresis

  • Measure electron transfer activity using spectrophotometric assays

  • Evaluate proton pumping efficiency with membrane potential-sensitive dyes

  • Quantify reactive oxygen species production, which often increases with Complex I dysfunction

Particular attention should be paid to the mt10689 G>A variant, which has been associated with altered glycerophospholipid metabolism in genome-wide association studies .

What is the relationship between MT-ND4L variants and metabolic adaptations?

Research has identified significant associations between MT-ND4L variants and metabolomic profiles. The mitochondrial SNV at position 10689 (rs879102108, G>A), a missense mutation in MT-ND4L, has been associated with altered ratios of phosphatidylcholines (PC ae C34:3/PC aa C36:6 and PC ae C34:1/PC aa C36:6) with p-values of 1.44×10⁻⁷ and 7.37×10⁻⁷ respectively . Similarly, a variant at position 10645 in MT-ND4L shows association with the ratio of sphingomyelin C26:0 to phosphatidylcholine C36:5 (p=1.93×10⁻⁷) . These findings suggest MT-ND4L variants may influence metabolic pathways beyond simple bioenergetics, potentially affecting membrane composition or lipid metabolism.

For research in this area, investigators should:

  • Perform targeted metabolomic profiling focusing on glycerophospholipids and sphingolipids

  • Use stable isotope labeling to track metabolic flux changes

  • Correlate metabolic changes with measurements of mitochondrial function

How can researchers investigate the role of MT-ND4L in high-altitude adaptation?

Research on Tibetan yaks and cattle has demonstrated that specific MT-ND4L haplotypes (particularly haplotype Ha1) show positive associations with high-altitude adaptability, while haplotype Ha3 is negatively associated with this adaptability (p<0.0017) . To investigate similar adaptations in primate species like Avahi unicolor, researchers should:

  • Compare MT-ND4L sequences from populations at different altitudes

  • Measure oxygen consumption rates of cells expressing different MT-ND4L variants

  • Assess reactive oxygen species production under hypoxic conditions

  • Evaluate mitochondrial membrane potential and ATP production during oxygen limitation

These approaches can reveal how MT-ND4L variants might contribute to metabolic adaptations in different ecological niches.

What statistical approaches are appropriate for analyzing associations between MT-ND4L variants and metabolic phenotypes?

Based on previous genomic studies of MT-ND4L, researchers should consider these statistical approaches:

  • Linear regression analysis for continuous metabolic traits, with appropriate correction for multiple testing. Studies have used effective number of tests (Meff) correction with significance thresholds of p<1.257545×10⁻⁵

  • Calculate metabolite ratio p-gain values, with thresholds equal to the total number of metabolites tested

  • For genetic association studies, implement models that account for mitochondrial haplogroup background

  • When analyzing high-altitude adaptation, use statistical tests that can detect positive selection, such as those employed in studies of Tibetan yaks (p<0.0017 for haplotype associations)

How should researchers interpret conflicting data regarding MT-ND4L function across different experimental systems?

When confronted with contradictory results across different experimental systems, researchers should:

  • Evaluate methodological differences that might explain discrepancies

  • Consider species-specific differences in MT-ND4L sequence and function

  • Assess whether nuclear genetic background influences MT-ND4L function

  • Test whether environmental conditions (oxygen levels, substrate availability) affect experimental outcomes

  • Determine if compensatory mechanisms might mask primary effects in some systems

A comprehensive approach integrating multiple experimental models provides the most robust interpretation of MT-ND4L function.

What novel techniques are emerging for studying the structure-function relationship of MT-ND4L?

Emerging technologies for studying MT-ND4L structure-function relationships include:

  • Cryo-electron microscopy at resolutions approaching 2-3Å, capable of resolving side-chain orientations within Complex I

  • Mitochondria-targeted genome editing using base editors or prime editors

  • Advanced computational modeling using AlphaFold or similar AI-based prediction tools, similar to the AF_AFQ5ZNA2F1 model developed for Zaglossus bruijni MT-ND4L (with a pLDDT global score of 89.71)

  • Single-molecule tracking in live cells to monitor MT-ND4L integration into Complex I

These approaches promise to provide unprecedented insights into how this small but critical protein contributes to mitochondrial function.

How might research on Avahi unicolor MT-ND4L contribute to understanding primate evolution?

Avahi unicolor (the eastern woolly lemur) represents a unique evolutionary lineage among primates. Comparative studies of its MT-ND4L could:

  • Identify lemur-specific adaptations in mitochondrial function

  • Reveal how environmental pressures in Madagascar shaped mitochondrial evolution

  • Provide insights into the metabolic adaptations supporting folivory and nocturnal lifestyle

  • Contribute to our understanding of convergent evolution in mitochondrial genes across distant primate lineages

Such research requires careful phylogenetic analysis and functional characterization of recombinant proteins from multiple species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.