Recombinant Avena sativa Chlorophyll synthase, chloroplastic (CHLG)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
CHLG; Chlorophyll synthase, chloroplastic; Polyprenyl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
46-378
Protein Length
Full Length of Mature Protein
Species
Avena sativa (Oat)
Target Names
CHLG
Target Protein Sequence
CAADADAKETTKKPTIPDKAPAAGSSFNQLLGIKGAKQETNIWKIRLQLTKPVTWPPLVW GVLCGAAASGNFHWTVEDVTKSIVCMLMSGPCLTGYTQTINDWYDRDIDAINEPYRPIPS GAISENEVITQIWVLLLGGLGLGALLDIWAGHDFPIIFYLALGGSLLSYIYSAPPLKLKQ NGWIGNFALGASYIGLPWWAGQALFGTLTPDIVVLTCLYSIAGLGIAIVNDFKSIEGDRT LGLQSLPVAFGMETAKWICVGAIDITQLSVAAYLLSTGKLYYALALLGLTIPQVILQFQY FLKDPVKYDVKYQASAQPFFVFGLLVTALATSH
Uniprot No.

Target Background

Function
Chlorophyll synthase, a chloroplast-localized enzyme, participates in the final stages of chlorophyll a biosynthesis. It catalyzes the esterification of chlorophyllide a with either geranylgeranyldiphosphate (GGPP) or phytyldiphosphate (PhyPP). The enzyme can also utilize the monophosphates GGMP and PhyMP with lower efficiency, but not the non-phosphorylated alcohols geranylgeraniol and phytol. The tetraprenyl diphosphate must bind to the enzyme as the initial substrate. Esterification occurs when the pre-loaded enzyme encounters the second substrate, chlorophyllide.
Database Links

KEGG: ag:CAB85464

Protein Families
UbiA prenyltransferase family, Chlorophyll synthase subfamily
Subcellular Location
Plastid, chloroplast membrane; Multi-pass membrane protein.

Q&A

What is the structure and sequence of Avena sativa chlorophyll synthase?

The chlorophyll synthase from Avena sativa consists of 378 amino acids, including a presequence of 46 amino acids that serves as a transit peptide for chloroplast targeting . The mature protein shows significant homology with other chlorophyll synthases, specifically 85% identity with Arabidopsis thaliana chlorophyll synthase and 62% identity with Synechocystis PCC 6803 . The enzyme's core protein, comprising amino acid residues 88-377, retains enzymatic activity, indicating that the N-terminal region (residues 47-87) is not essential for catalysis .

Secondary structure analysis using HMMTOP predicts that the enzyme contains 9 membrane-spanning helices, consistent with its localization in the thylakoid membrane . The presence of multiple transmembrane domains aligns with the enzyme's role in the chloroplast membrane system.

What are the substrate requirements for recombinant Avena sativa chlorophyll synthase?

Recombinant chlorophyll synthase from Avena sativa catalyzes the esterification of chlorophyllide a with various prenyl diphosphates . The enzyme exhibits differential activity toward:

  • Phytyl diphosphate (PhyPP) - Utilized efficiently, especially during prolonged reactions

  • Geranylgeranyl diphosphate (GGPP) - Shows faster initial reaction rates compared to PhyPP but lower total yield in extended incubations

  • Geranylgeranyl monophosphate (GGMP) - Accepted by the enzyme but with only 50-60% of the yield compared to GGPP

Unlike native enzyme preparations from etioplast membranes, the recombinant enzyme does not accept free alcohols (geranylgeraniol or phytol) even in the presence of ATP, suggesting that etioplasts contain a specific kinase not present in the bacterial expression system .

What cofactors are required for chlorophyll synthase activity?

Magnesium ions (Mg²⁺) are essential for chlorophyll synthase activity . The recombinant enzyme from Avena sativa shows strong binding of Mg²⁺, requiring high concentrations of EDTA to remove the metal and inhibit activity . When Mg²⁺ is removed by EDTA treatment, enzyme activity is dramatically reduced to approximately 2% of normal levels .

Activity can be restored by adding back Mg²⁺ (95% recovery), and to a lesser extent by Mn²⁺ (31% recovery) or Zn²⁺ (14% recovery), while Ca²⁺ shows no significant restoration effect . This demonstrates the specific requirement for divalent metal ions, with Mg²⁺ being the most effective cofactor for enzyme function.

How is the chlorophyll synthase gene expressed in plants?

The chlorophyll synthase gene is constitutively expressed in Avena sativa, with similar transcript levels detected in both dark-grown (etiolated) and light-grown seedlings . Northern blot analysis of 3, 4, and 5-day-old oat seedlings confirms that there are no significant differences in expression levels between etiolated and green plants .

These findings align with results from Arabidopsis thaliana, where Southern and Northern blot analyses indicated that chlorophyll synthase is encoded by a single-copy gene . The constitutive expression pattern suggests that regulation of chlorophyll synthesis likely occurs at post-transcriptional levels rather than through modulation of gene expression.

What reaction mechanism does chlorophyll synthase follow?

Chlorophyll synthase from Avena sativa operates through a "ping-pong" reaction mechanism, as evidenced by Lineweaver-Burk plots for both chlorophyllide a and phytyl diphosphate concentrations showing parallel lines . In this mechanism:

  • The tetraprenyl diphosphate (e.g., phytyl diphosphate) binds to the enzyme first as the initial substrate

  • The enzyme undergoes a conformational change before binding the second substrate

  • Chlorophyllide then binds to the pre-loaded enzyme

  • Esterification occurs, forming chlorophyll

  • The final product is released

Pre-incubation experiments provide further support for this mechanism. When the enzyme is pre-incubated with phytyl diphosphate, an initial rapid reaction phase is observed that does not occur after pre-incubation with chlorophyllide . This indicates that approximately 10-17% of the recombinant enzyme becomes pre-loaded with phytyl diphosphate under experimental conditions .

Importantly, this rapid reaction phase is also observed in etiolated barley leaves, suggesting that pre-loading of the enzyme with tetraprenyl diphosphate occurs in vivo as well as in vitro .

Which amino acid residues are critical for chlorophyll synthase activity?

Site-directed mutagenesis studies have identified several key amino acid residues essential for the activity of Avena sativa chlorophyll synthase:

  • Arginine residues: Of the four arginine residues present in the active core protein, Arg-91 and Arg-161 are essential for enzymatic activity . These positively charged residues likely participate in substrate binding or in maintaining the proper conformation of the active site.

  • Cysteine residues: Among the five cysteine residues present in the core protein, only Cys-109 is essential for enzyme activity . Mutation of this residue results in loss of function, suggesting it plays a crucial role in the catalytic mechanism.

  • Inhibitor binding site: The inhibitor N-phenylmaleimide (NPM) inhibits both wild-type enzyme and all cysteine mutants except C304A, indicating that it binds to a non-essential cysteine residue (likely Cys-304) to abolish activity . This suggests that while Cys-304 is not directly involved in catalysis, its modification can disrupt enzyme function through allosteric effects.

These findings provide insights into the structure-function relationship of chlorophyll synthase and potential targets for enzyme engineering.

What is the substrate preference kinetics of recombinant chlorophyll synthase?

When presented with a mixture of phytyl diphosphate (PhyPP) and geranylgeranyl diphosphate (GGPP), the recombinant chlorophyll synthase from Avena sativa exhibits time-dependent substrate preference :

  • In the initial reaction phase (1-15 minutes), chlorophyll esterified with geranylgeranyl (ChlGG) predominates

  • In later reaction phases (15-180 minutes), chlorophyll esterified with phytyl (ChlPhy) becomes the predominant product

This shift in product distribution over time suggests different binding affinities and turnover rates for the two substrates. The enzyme initially reacts faster with GGPP, but achieves higher total esterification with PhyPP during prolonged incubation . This kinetic behavior may reflect the enzyme's biological role in producing both chlorophyll a (phytylated) and chlorophyll derivatives containing geranylgeranyl.

What regulatory role does chlorophyll synthase play beyond catalysis?

Beyond its enzymatic function, chlorophyll synthase appears to have a regulatory or channeling role in chlorophyll metabolism and the assembly of photosynthetic complexes . This role is evidenced by in vitro translation experiments with plastid preparations, which show that:

  • Chlorophyll-binding proteins (P700, CP43, CP47, D1) accumulate only when chlorophyll is synthesized de novo via the chlorophyll synthase reaction in the translation mixture

  • No accumulation of these proteins is observed when chlorophyll itself is added to the translation mixture

The most probable explanation for this phenomenon is the direct transfer of newly synthesized chlorophyll from chlorophyll synthase to nascent chlorophyll-binding proteins . This suggests that chlorophyll synthase functions not only as an enzyme but also as a component of a larger biosynthetic complex that coordinates chlorophyll synthesis with protein assembly in photosynthetic membranes.

How can recombinant Avena sativa chlorophyll synthase be expressed and purified?

The successful expression of functional Avena sativa chlorophyll synthase has been achieved using Escherichia coli as a heterologous expression system . The methodology involves:

  • Cloning: The chlorophyll synthase gene is isolated from a cDNA preparation of 4-day-old etiolated oat seedlings using conserved regions as primers

  • Expression vector construction: The gene is inserted into an appropriate expression vector with a promoter compatible with E. coli transcription machinery

  • Bacterial transformation: E. coli cells are transformed with the expression construct and cultured under conditions that induce protein expression

  • Membrane preparation: Since chlorophyll synthase is a membrane protein, preparation of bacterial membrane fractions is typically required for activity assays

  • Activity verification: The identity and functionality of the recombinant enzyme are verified by comparing reaction rates with several chlorophyllide analogs between the recombinant and native enzyme preparations

For functional studies, the full-length protein including the presequence is typically used, though it has been demonstrated that a core protein comprising amino acid residues 88-377 retains enzymatic activity .

What assay methods are effective for measuring chlorophyll synthase activity?

Chlorophyll synthase activity can be measured using several complementary approaches:

  • Substrate conversion assay: The enzyme is incubated with chlorophyllide a and a prenyl diphosphate (PhyPP or GGPP), and the formation of esterified product is monitored over time

  • Spectroscopic analysis: The conversion of chlorophyllide to chlorophyll can be monitored by changes in absorption spectrum or fluorescence properties

  • Kinetic analysis: Lineweaver-Burk plots with varying concentrations of both substrates can be used to determine the reaction mechanism and kinetic parameters

  • Pre-incubation studies: Pre-incubating the enzyme with one substrate before adding the second can reveal the order of substrate binding and conformational changes

For accurate activity measurements, it is important to include appropriate cofactors (particularly Mg²⁺) and to prepare membrane fractions carefully to preserve enzyme structure and function .

How can site-directed mutagenesis be used to study chlorophyll synthase function?

Site-directed mutagenesis has proven valuable for identifying essential amino acid residues in chlorophyll synthase . The approach involves:

  • Target selection: Based on sequence conservation or structural predictions, specific amino acids are selected for mutation (such as arginine and cysteine residues)

  • Mutagenesis protocol: Standard molecular biology techniques are used to introduce specific mutations into the gene sequence

  • Expression of mutants: The mutated genes are expressed in E. coli under the same conditions as the wild-type enzyme

  • Activity comparison: The enzymatic activity of each mutant is compared to the wild-type enzyme to determine the impact of the mutation

  • Inhibitor studies: The sensitivity of mutants to enzyme inhibitors like N-phenylmaleimide can provide additional insights into the roles of specific residues

This approach has successfully identified key functional residues such as Arg-91, Arg-161, and Cys-109 as essential for enzyme activity , providing valuable information about the catalytic mechanism of chlorophyll synthase.

What are the remaining questions about the structure-function relationship of chlorophyll synthase?

Despite significant advances, several aspects of chlorophyll synthase structure and function remain to be elucidated:

  • The complete three-dimensional structure of chlorophyll synthase has not yet been determined by X-ray crystallography or cryo-electron microscopy, limiting our understanding of its catalytic mechanism at the molecular level

  • The precise roles of the nine transmembrane helices in substrate binding, catalysis, and interaction with other proteins remain unclear

  • The molecular basis for the differential kinetics observed with PhyPP versus GGPP has not been fully explained

  • The mechanism by which the enzyme coordinates with other components of the chlorophyll biosynthetic pathway and chlorophyll-binding proteins requires further investigation

How might chlorophyll synthase interact with other components of photosynthetic assembly?

The regulatory role of chlorophyll synthase in the assembly of photosynthetic complexes raises intriguing questions about protein-protein interactions and coordinated biosynthesis :

  • The direct transfer of newly synthesized chlorophyll from chlorophyll synthase to nascent chlorophyll-binding proteins suggests physical interactions between these components

  • The temporal and spatial coordination of chlorophyll synthesis with protein translation and membrane insertion remains poorly understood

  • The potential existence of a larger biosynthetic supercomplex that includes chlorophyll synthase and other enzymes of chlorophyll metabolism warrants investigation

Advanced techniques such as protein crosslinking, fluorescence resonance energy transfer (FRET), and native mass spectrometry could help identify interaction partners and characterize these potential complexes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.