Recombinant Avena sativa V-type proton ATPase 16 kDa proteolipid subunit (VATP-P1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
VATP-P1; V-type proton ATPase 16 kDa proteolipid subunit; V-ATPase 16 kDa proteolipid subunit; Vacuolar proton pump 16 kDa proteolipid subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-165
Protein Length
full length protein
Species
Avena sativa (Oat)
Target Names
VATP-P1
Target Protein Sequence
MSSVFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVV MAGVLGIYGLIIAVIISTGINPKAKPYFLFDGYAHLSSGLACGLAGLAAGMAIGIVGDAG VRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSRAD
Uniprot No.

Target Background

Function

The 16 kDa proteolipid subunit (VATP-P1) is a proton-conducting pore-forming subunit of the V0 membrane integral complex within the vacuolar ATPase (V-ATPase). V-ATPase is crucial for acidifying various intracellular compartments in eukaryotic cells.

Protein Families
V-ATPase proteolipid subunit family
Subcellular Location
Vacuole membrane; Multi-pass membrane protein. Note=Tonoplast.

Q&A

What is the genomic origin of VATP-P1 in Avena sativa?

The VATP-P1 gene in Avena sativa is located within the chloroplast genome. Comparative chloroplast genome analyses across eleven Avena species have revealed significant conservation of essential genes, including those encoding ATP synthase components . The gene is part of the highly conserved regions in the chloroplast LSC (Large Single Copy) region, which contains approximately 64.97% of the repeats found in the Avena hirtula plastome . When investigating the genomic origin of VATP-P1, researchers should consider the complex evolutionary relationships within the Avena genus, which has been divided into two strongly supported infrageneric lineages: clade I containing A-genome diploid-polyploid species (including A. sativa), and clade II containing C-genome diploid lineages .

What expression systems are most suitable for recombinant VATP-P1 production?

When selecting an expression system for recombinant VATP-P1 production, researchers should consider the following methodological approaches:

For optimal results, researchers should implement a randomized complete block design with at least 3-4 biological replicates for each expression condition tested . Expression conditions should be systematically varied to identify optimal parameters for protein yield and functionality.

How can VATP-P1 be purified while maintaining its functional integrity?

Purification of functionally active VATP-P1 requires careful consideration of its membrane-associated nature. A methodological approach should include:

  • Membrane isolation: Begin with gentle cell lysis followed by differential centrifugation to isolate membrane fractions containing the VATP-P1 protein.

  • Detergent solubilization: Screen multiple detergents (CHAPS, DDM, Triton X-100) at various concentrations to identify optimal solubilization conditions that maintain protein structure.

  • Chromatography sequence: Implement a multi-step purification strategy:

    • Initial capture using affinity chromatography (if tagged)

    • Intermediate purification using ion exchange chromatography

    • Polishing step using size exclusion chromatography

  • Activity verification: Throughout purification, samples should be tested for ATP hydrolysis activity using spectrophotometric assays that couple ATPase activity to NADH oxidation.

The experimental design should include control samples at each purification step to track protein yield and activity, with statistical analysis to determine if differences between purification methods are significant .

What are the key structural characteristics of VATP-P1?

The VATP-P1 from Avena sativa is a 16 kDa proteolipid subunit of the V-type proton ATPase. Its structural characteristics include:

  • Transmembrane domains: The protein contains multiple hydrophobic transmembrane α-helices that span the membrane.

  • Conserved glutamate residue: A key glutamate residue in one of the transmembrane helices is essential for proton translocation.

  • Oligomerization interfaces: The subunit contains regions that facilitate interaction with other proteolipid subunits to form a ring structure.

  • N-terminal domain: This region faces the cytoplasmic side and interacts with other V-ATPase subunits.

Structural analysis techniques should incorporate appropriate statistical methods for validation, similar to those used in genomic sequence verification of Avena species . The relationship between structure and function can be investigated using site-directed mutagenesis of conserved residues, followed by functional assays.

How does the expression of VATP-P1 vary across different tissues and developmental stages in Avena sativa?

The expression pattern of VATP-P1 varies significantly across different tissues and developmental stages in Avena sativa. A comprehensive methodological approach to studying this variation includes:

  • Tissue-specific expression analysis:

    • Sample collection from distinct tissues (roots, stems, leaves, developing seeds)

    • RNA extraction and quality validation (RIN > 8.0)

    • RT-qPCR analysis using gene-specific primers

    • Normalization against at least three stable reference genes

  • Developmental time-course studies:

    • Systematic sampling throughout the plant life cycle

    • Correlation of expression with developmental milestones

    • Statistical analysis using time-series methods

When designing these experiments, researchers should employ a factorial design that accounts for both tissue type and developmental stage as experimental factors . Analysis of variance (ANOVA) should be conducted to determine significance, followed by appropriate post-hoc tests.

Expression patterns may correlate with specific physiological processes in Avena sativa, such as nutrient transport in developing seeds or stress responses. These can be compared to patterns observed in other Avena species to identify evolutionary conservation of expression regulation .

What experimental approaches can resolve contradictory findings regarding VATP-P1 function?

When faced with contradictory findings about VATP-P1 function, researchers should implement the following methodological framework:

  • Standardization of experimental conditions:

    • Define precise growth conditions for Avena sativa

    • Standardize protein isolation and purification protocols

    • Develop consistent activity assays with clear positive and negative controls

  • Multi-method validation approach:

    • Combine in vitro biochemical assays with in vivo functional studies

    • Use both heterologous expression systems and native tissue analysis

    • Apply complementary biophysical techniques (e.g., SPR, ITC, MST) to validate protein interactions

  • Statistical resolution of discrepancies:

    • Meta-analysis of published results

    • Power analysis to determine appropriate sample sizes

    • Implementation of blinded experimental designs to minimize bias

  • Genetic approaches:

    • CRISPR/Cas9 genome editing to create precise mutations

    • Complementation assays in knockout lines

    • Conditional expression systems to study temporal requirements

The experimental design should include randomization, replication, and blocking where appropriate to control for confounding variables . Data should be analyzed using appropriate statistical methods, with clear reporting of effect sizes alongside p-values.

How can genomic and proteomic approaches be integrated to characterize VATP-P1 variants in different Avena species?

Integration of genomic and proteomic approaches provides powerful insights into VATP-P1 variants across Avena species. A comprehensive methodology includes:

ApproachTechniquesAnalytical MethodsExpected Outcomes
GenomicWhole genome sequencingComparative sequence analysisIdentification of VATP-P1 gene variants
Targeted resequencingPhylogenetic analysisEvolutionary relationships of variants
SNP detectionLinkage mappingAssociation with phenotypic traits
ProteomicLC-MS/MSPeptide mappingProtein sequence verification
2D-PAGEDifferential expression analysisTissue-specific expression patterns
Co-immunoprecipitationInteraction network analysisProtein-protein interaction partners
IntegrativeCorrelation analysisMulti-omics data integrationFunction-sequence relationships
Systems biology modelingPathway analysisBiological context of variants

This integrated approach has successfully been applied in comparative studies of Avena species, revealing significant correlations between genomic features such as tandem repeats, indels, and SNPs . The correlation between tandems and indels (Spearman's Rho = 0.3585, p < 0.01) is particularly relevant when studying structural variations in the VATP-P1 gene .

Researchers should implement appropriate experimental designs that account for species differences, with sufficient biological replication to capture intraspecific variation .

What role does VATP-P1 play in Avena sativa stress responses, and how can this be experimentally validated?

VATP-P1, as a component of the V-type proton ATPase complex, plays a crucial role in cellular pH regulation and stress response mechanisms in Avena sativa. A methodological framework for characterizing this role includes:

  • Stress-specific expression analysis:

    • Subject plants to controlled stress conditions (drought, salt, cold, heat)

    • Monitor VATP-P1 expression changes via RT-qPCR

    • Compare with known stress-responsive genes

    • Correlate expression with physiological parameters

  • Functional validation approaches:

    • Generate transgenic lines with altered VATP-P1 expression

    • Assess stress tolerance phenotypes using standardized assays

    • Measure vacuolar pH changes using fluorescent probes

    • Quantify metabolite profiles under stress conditions

  • Subcellular localization studies:

    • Create fluorescent protein fusions

    • Perform co-localization studies with organelle markers

    • Track dynamic localization changes during stress responses

The experimental design should incorporate a factorial approach with stress type and intensity as experimental factors, and appropriate blocking to control for environmental variations . Statistical analysis should include multivariate methods to correlate gene expression with physiological parameters.

Similar approaches have been used successfully to characterize stress-responsive genes in various Avena species, providing a methodological foundation for VATP-P1 research .

How can advanced biophysical techniques elucidate the proton transport mechanism of VATP-P1?

Elucidating the proton transport mechanism of VATP-P1 requires sophisticated biophysical techniques applied in a coordinated research strategy:

  • Structural studies:

    • X-ray crystallography of purified VATP-P1 (resolution < 2.5 Å)

    • Cryo-EM of the intact V-ATPase complex (resolution < 3.5 Å)

    • NMR spectroscopy for dynamic structural elements

    • Molecular dynamics simulations to model proton movement

  • Functional assays:

    • Site-directed mutagenesis of key residues

    • Electrophysiological measurements using reconstituted proteoliposomes

    • Proton flux measurements using pH-sensitive fluorescent probes

    • ATP hydrolysis coupling efficiency determination

  • Kinetic analyses:

    • Pre-steady-state kinetics to identify rate-limiting steps

    • Temperature-dependent kinetics to determine activation energies

    • Isotope effects to probe proton transfer mechanisms

  • Interaction studies:

    • FRET analysis to measure subunit interactions

    • Cross-linking coupled with mass spectrometry to map interaction interfaces

    • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

The research design should systematically test mechanistic hypotheses through carefully controlled experiments with appropriate replication . Results from different techniques should be integrated to build a comprehensive model of the proton transport mechanism.

What are the key considerations for experimental design when studying VATP-P1?

Designing robust experiments to study VATP-P1 requires careful consideration of multiple factors:

  • Sample size determination:

    • Conduct power analysis based on expected effect sizes

    • Ensure sufficient biological replicates (minimum n=3)

    • Include technical replicates to assess measurement variation

  • Control selection:

    • Include positive controls (known V-ATPase inhibitors or activators)

    • Implement negative controls (inactive mutants)

    • Use scrambled siRNAs or empty vectors in genetic studies

  • Randomization and blinding:

    • Randomize sample processing order

    • Implement blinded analysis where possible

    • Use blocking to control for batch effects

  • Statistical considerations:

    • Select appropriate statistical tests based on data distribution

    • Control for multiple testing when performing genome-wide analyses

    • Report effect sizes alongside p-values

As emphasized in experimental design literature, researchers should explicitly connect the objectives of their research to the type of experimental design required, and carefully execute the plan with proper randomization .

How can advanced genomic tools be applied to study VATP-P1 evolution across Avena species?

The study of VATP-P1 evolution across Avena species benefits from advanced genomic approaches:

  • Comparative genomics workflow:

    • Obtain sequence data from diverse Avena species

    • Align VATP-P1 sequences and flanking regions

    • Identify conserved and variable domains

    • Construct phylogenetic trees to infer evolutionary relationships

  • Selection analysis:

    • Calculate dN/dS ratios to detect selection signatures

    • Identify sites under positive or purifying selection

    • Map selection patterns to functional domains

  • Genetic diversity assessment:

    • Characterize haplotype diversity across populations

    • Calculate nucleotide diversity (π) and Tajima's D

    • Identify patterns of linkage disequilibrium

Recent comparative chloroplast genome analyses of Avena species provide an excellent methodological framework, revealing significant correlations between genomic features . The phylogenomic analyses have substantially increased resolution of Avena evolutionary relationships, separating species into distinct clades that can inform VATP-P1 evolutionary studies .

What are the most reliable methods for quantifying VATP-P1 expression levels?

Reliable quantification of VATP-P1 expression requires selecting appropriate methods based on research questions:

MethodApplicationAdvantagesLimitationsStatistical Considerations
RT-qPCRTargeted gene expressionHigh sensitivity, wide dynamic rangeRequires stable reference genesNormalization using multiple reference genes, efficiency correction
RNA-SeqGenome-wide expressionUnbiased, discovery of novel transcriptsHigher cost, complex data analysisDepth normalization, batch effect correction
Proteomics (LC-MS/MS)Protein abundanceDirect measurement of protein levelsLimited sensitivity for low-abundance proteinsNormalization using spike-in standards
Western blottingProtein expression validationSpecific detection, semi-quantitativeAntibody specificity issuesLinear range determination, loading control normalization
GFP reporter assaysPromoter activityIn vivo monitoring, tissue specificityConstruct artifacts, positional effectsBackground subtraction, standardization of imaging parameters

For highest reliability, researchers should implement multiple complementary methods. When designing RT-qPCR experiments, selection of appropriate reference genes is critical, as demonstrated in studies of gene expression in Avena species .

The experimental design should include stratified sampling across tissues and developmental stages to capture the full range of expression variation .

How might CRISPR/Cas9 genome editing advance VATP-P1 functional studies in Avena sativa?

CRISPR/Cas9 genome editing offers transformative potential for VATP-P1 functional studies in Avena sativa:

  • Precision mutation strategies:

    • Create targeted knockouts of VATP-P1

    • Generate specific point mutations in functional domains

    • Develop regulatory element modifications to alter expression patterns

    • Engineer tagged versions for localization and interaction studies

  • Methodological considerations:

    • Design guide RNAs with minimal off-target effects

    • Optimize transformation protocols for Avena sativa

    • Develop efficient screening methods for edited plants

    • Implement appropriate controls for phenotypic analysis

  • Advanced applications:

    • Create conditional knockout systems using inducible promoters

    • Develop multiplexed editing to target multiple V-ATPase subunits

    • Implement base editing for precise single nucleotide modifications

    • Utilize prime editing for specific sequence replacements

When designing these experiments, researchers should employ factorial designs to test multiple variables, with appropriate randomization and replication . The genetic background used should be well-characterized, potentially utilizing lines from genetic mapping studies such as those conducted for the Dw6 gene in Avena sativa .

What interspecies comparative approaches can reveal about VATP-P1 functional adaptation?

Comparative studies across Avena species can provide valuable insights into VATP-P1 functional adaptation:

  • Systematic comparative methodology:

    • Sequence VATP-P1 from diploid, tetraploid, and hexaploid Avena species

    • Characterize expression patterns across diverse environments

    • Measure biochemical properties of recombinant proteins

    • Correlate sequence variations with functional differences

  • Ancestral sequence reconstruction:

    • Infer ancestral VATP-P1 sequences

    • Express and characterize ancestral proteins

    • Compare properties with extant variants

    • Identify key evolutionary transitions

  • Environmental correlation analysis:

    • Sample Avena species across environmental gradients

    • Correlate VATP-P1 sequence/function with ecological parameters

    • Test adaptive hypotheses through reciprocal transplant experiments

This approach builds on the methods used in comparative chloroplast genome analyses of Avena, where eleven species were examined to understand evolutionary dynamics . The phylogenomic analyses that identified two major infrageneric lineages provide an evolutionary framework for interpreting VATP-P1 functional adaptations .

How can systems biology approaches integrate VATP-P1 function into cellular energy homeostasis networks?

Systems biology offers powerful frameworks for contextualizing VATP-P1 function within broader cellular networks:

  • Multi-omics integration strategy:

    • Generate coordinated transcriptomic, proteomic, and metabolomic datasets

    • Identify co-expression networks associated with VATP-P1

    • Map metabolic changes linked to VATP-P1 activity

    • Construct predictive models of energy homeostasis

  • Network analysis approaches:

    • Perform weighted gene correlation network analysis (WGCNA)

    • Identify hub genes and regulatory modules

    • Quantify network perturbations under stress conditions

    • Validate key interactions experimentally

  • Flux balance analysis:

    • Develop constraint-based models of proton and energy fluxes

    • Simulate the effects of VATP-P1 variants on cellular energetics

    • Predict phenotypic outcomes of altered VATP-P1 function

    • Validate predictions with experimental measurements

The experimental design should incorporate multiple environmental conditions and genetic backgrounds to capture system-wide responses . Statistical approaches similar to those used in biplot analyses of RIL lines in Avena could be applied to identify relationships between VATP-P1 function and phenotypic traits .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.