Recombinant Avian infectious bronchitis virus Membrane protein (M)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
M; Membrane protein; M protein; E1 glycoprotein; Matrix glycoprotein; Membrane glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-223
Protein Length
full length protein
Species
Avian infectious bronchitis virus (strain Gray) (IBV)
Target Names
M
Target Protein Sequence
MAENCTLDSEQAVLLFKEYNLFITAFLLFLTILLQYGYATRSRTIYILKMIVLWCFWPLN IAVGVISCIYPPNTGGLVAAIILTVFACLSFVGYWIQSCRLFKRCRSWWSFNPESNAVGS ILLTNGQQCNFAIESVPMVLAPIIKNGVLYCEGQWLAKCEPDHLPKDIFVCTPDRRNIYR MVQKYTGDQSGNKKRFATFVYAKQSVDTGELESVATGGSSLYT
Uniprot No.

Target Background

Function
A component of the viral envelope, this protein plays a crucial role in viral morphogenesis and assembly through interactions with other viral proteins.
Protein Families
Gammacoronaviruses M protein family
Subcellular Location
Virion membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the general structure and genomic location of the IBV M protein?

The M protein is encoded by the M gene, which is located in the 3' portion of the IBV genome in the arrangement 5′-1a,b-S(S1,S2)-3a,b,c(E)-M-5a,b-N-Poly(A)-3′. In emerging recombinant IBV isolates, the M gene contains 672 nucleotides encoding a protein of 224 amino acids. The M protein has a distinctive structure featuring three transmembrane domains at the N-terminal region, which anchor the protein into the viral envelope . These transmembrane regions can be accurately predicted using bioinformatics tools such as transmembrane hidden Markov models (TMHMM), which have demonstrated high accuracy in mapping the topological structure of the M protein .

What role does the M protein play in IBV immunogenicity compared to other structural proteins?

Unlike the S1 glycoprotein, which is a primary inducer of protective immunity, the M protein appears to play a secondary role in inducing protection in vaccinated chickens. Research has demonstrated that "the S1 glycoprotein but not the N or M proteins of avian infectious bronchitis virus induces protection in vaccinated chickens" . This finding has directed vaccine development efforts toward focusing on the S protein, particularly in recombinant vaccine approaches where the S gene from virulent strains is incorporated into attenuated backbones . Nevertheless, the M protein remains important for virus structure and potentially as a supplementary target for comprehensive vaccine strategies.

What are the most effective sequencing protocols for characterizing novel M protein variants in recombinant IBV strains?

For comprehensive characterization of M protein variants in recombinant IBV strains, next-generation sequencing using platforms such as Ion Torrent PGM provides excellent depth and coverage. The recommended methodology involves:

  • RNA extraction from viral samples using commercial kits

  • Library construction using the Ion Total RNA-Seq kit

  • Library pretreatment using the Ion PGM Template OT2 Kit

  • Sequencing on an Ion 318 chip with the Ion PGM Sequencing Kit

  • Quality control and adaptor removal using Torrent Server

  • Sequence assembly against reference genomes using CLC genomics workbench

This approach regularly achieves sequencing depths exceeding 500×, ensuring high confidence in detecting mutations, insertions, and deletions within the M gene . For targeted analysis of specific M gene regions, RT-PCR amplification followed by direct Sanger sequencing remains a cost-effective approach, though it provides less comprehensive data than whole-genome sequencing methods.

How can researchers differentiate between naturally occurring and laboratory-induced mutations in the M protein during recombinant IBV development?

Distinguishing natural from laboratory-induced mutations requires a multi-layered analytical approach:

  • Comparative genomics analysis: Compare the M gene sequence with extensive databases of field isolates to determine if mutations exist in natural populations.

  • Passage stability assessment: Monitor the stability of mutations during in vitro and in ovo passaging, as laboratory-induced mutations often show lower stability. Research has shown that true attenuating mutations are typically maintained during passaging in vitro and in ovo .

  • Evolutionary pressure analysis: Calculate the ratio of non-synonymous to synonymous substitutions (dN/dS) to identify regions under selective pressure.

  • Mutation pattern analysis: Laboratory-induced mutations often occur at specific sites associated with adaptation to culture conditions.

  • Consensus sequence comparison: Compare the consensus sequence before and after multiple passages to identify emerging mutations.

This systematic approach helps researchers accurately categorize mutations as either naturally occurring variants or artifacts of laboratory manipulation.

What bioinformatic approaches can predict functional impacts of M protein mutations in recombinant IBV strains?

Several advanced bioinformatic approaches can predict the functional consequences of M protein mutations:

  • Transmembrane topology prediction: Tools like TMHMM can accurately predict how mutations affect the transmembrane domains of the M protein and potential alterations to membrane anchoring .

  • Protein stability analysis: ΔΔG calculations can predict how mutations affect the thermodynamic stability of the protein structure.

  • Molecular dynamics simulations: Simulate the physical movements of M protein atoms to predict structural changes resulting from mutations.

  • Protein-protein interaction prediction: Analyze how mutations might impact interactions between M and other viral proteins, particularly during virion assembly.

  • Conservation analysis: Assess evolutionary conservation at mutated positions across coronavirus species, as highly conserved residues typically serve critical functions.

These computational approaches provide valuable preliminary insights that guide subsequent experimental validation of mutation effects.

How do the transmembrane domains of the M protein contribute to IBV assembly and morphogenesis?

The three transmembrane domains identified at the N-terminal of the M protein in IBV isolates play critical roles in virus assembly and morphogenesis . These domains:

  • Anchor the M protein firmly in the endoplasmic reticulum membrane and later in the viral envelope

  • Create a scaffold that helps determine virion shape and size

  • Interact with other viral structural proteins, particularly the E protein, to drive membrane curvature necessary for virus budding

  • Orient the C-terminal domain toward the cytoplasm where it can interact with the nucleocapsid (N) protein and viral RNA

The characteristic three-transmembrane topology is preserved across different IBV isolates, underscoring its functional importance . Alterations to these domains could significantly impact virus assembly efficiency and potentially virion stability, making them important targets for attenuating mutations in vaccine development.

What post-translational modifications occur in the IBV M protein, and how do they affect protein function?

The M protein undergoes several post-translational modifications that influence its functionality:

These modifications collectively influence the M protein's stability, interactions with other viral proteins, and potentially its recognition by the host immune system. Analyzing these modifications in recombinant IBV strains may reveal new attenuating targets for rational vaccine design.

What strategies exist for incorporating M protein modifications in recombinant IBV vaccine candidates?

Several strategic approaches can be used to modify the M protein in recombinant IBV vaccine development:

  • Specific deletions: Introduction of the previously identified 9 and 3 nucleotide deletions in the M gene that are characteristic of certain recombinant strains . These modifications could be incorporated using reverse genetics systems.

  • Transmembrane domain alterations: Targeted mutations in the three transmembrane regions of the M protein to potentially affect virus assembly while maintaining immunogenicity.

  • Epitope enhancement: Introduction of mutations that enhance exposure of M protein epitopes without compromising structural integrity.

  • Combined structural protein modifications: While the S protein is the primary target for vaccine development, complementary modifications to both S and M proteins could potentially enhance vaccine efficacy. Currently, research indicates that the presence of multiple attenuating mutations does not negatively impact vaccine efficacy .

How does the genetic stability of M protein compare to S protein in recombinant IBV strains during passaging?

The M protein generally demonstrates higher genetic stability than the S protein during viral passaging, making it potentially advantageous for maintaining consistent attenuation in vaccine strains. Research has shown that specific attenuating mutations can be stably maintained during passaging in vitro and in ovo .

While the search results don't provide specific comparative data on M vs. S protein stability during passaging, general coronavirus research indicates that:

  • The M gene experiences lower selective pressure than the S gene

  • The transmembrane regions of M protein are particularly conserved during passage

  • The lower rate of recombination affecting the M gene contributes to its stability

  • The essential structural role of M protein constrains viable mutations

This relative stability makes the M protein a potentially reliable target for attenuating mutations that are less likely to revert to virulence during vaccine production and deployment.

How can the M protein be targeted in rational attenuation strategies for IBV vaccines?

While current rational attenuation strategies have focused primarily on other viral components (such as the macrodomain where the N42A mutation has proven effective for attenuation ), the M protein offers several potential targets:

  • Transmembrane domain modification: Subtle alterations to transmembrane domains that maintain virus assembly but reduce efficiency or stability

  • C-terminal domain mutations: Modifications to regions that interact with the N protein and viral RNA

  • Introduction of specific deletions: The naturally occurring 9 and 3 nucleotide deletions observed in some recombinant strains could be introduced into other strains

  • Post-translational modification site alteration: Modification of glycosylation or phosphorylation sites to alter protein function

These approaches should be considered complementary to established attenuation methods targeting the macrodomain and other non-structural proteins, potentially creating multi-target attenuation strategies that reduce the risk of reversion to virulence .

What cell culture systems are optimal for studying M protein function in recombinant IBV strains?

The optimal cell culture systems for studying M protein function include:

  • Primary chicken embryo kidney (CEK) cells: Closely resemble natural host cells and support robust IBV replication

  • Chicken embryo fibroblasts (CEF): Useful for studying viral assembly and M protein localization

  • Vero cells: While not derived from avian sources, these cells have been successfully used in recombinant vaccinia virus (rVV) systems for IBV cDNA manipulation

  • DF-1 cells: An immortalized chicken fibroblast cell line useful for stable transfection studies

When selecting a cell system, researchers should consider:

  • The specific aspect of M protein function being studied

  • Whether the study focuses on virus assembly, protein-protein interactions, or immune responses

  • The compatibility with available analytical techniques

  • The relevance to in vivo conditions in chickens

For complete virus replication studies, embryonated chicken eggs (in ovo systems) remain the gold standard and have been used to demonstrate that mutations can be stably maintained during passaging .

What are the methodological challenges in distinguishing M protein-specific effects from those of other viral proteins?

Isolating M protein-specific effects presents several methodological challenges:

  • Functional redundancy: Some M protein functions may overlap with other viral proteins

  • Protein-protein interactions: The M protein interacts extensively with other viral proteins, making it difficult to isolate its specific contributions

  • Structural interdependence: Modifications to M protein may indirectly affect other proteins' positioning or function

To address these challenges, researchers can employ:

  • Trans-complementation assays: Provide wild-type M protein in trans while studying mutant M protein effects

  • Single-cycle replication systems: Allow analysis of early versus late stages of infection

  • Reverse genetics with protein tagging: Introduce epitope tags that allow specific tracking of M protein

  • Protein-protein interaction assays: Co-immunoprecipitation or proximity labeling to map M protein interactions

  • Cryo-electron microscopy: Visualize structural changes in virions with M protein mutations

These approaches help parse the specific contributions of M protein from the complex interplay of multiple viral components.

What parameters should be measured to comprehensively assess the impact of M protein modifications on viral fitness?

A comprehensive assessment of how M protein modifications affect viral fitness should include:

ParameterMethodologySignificance
Replication kineticsGrowth curves in various cell typesMeasures basic replication competence
Virion morphologyElectron microscopyAssesses impact on particle assembly
Thermal stabilityTemperature sensitivity assaysEvaluates virion structural integrity
RNA packaging efficiencyqRT-PCR of purified virionsDetermines genomic incorporation
Protein expression levelsWestern blottingConfirms proper protein production
In ovo growthEmbryonated egg infectionModels growth in primary production system
In vivo attenuationClinical signs scoring in chickensDirectly measures pathogenicity
In vivo protectionChallenge studies post-vaccinationDetermines vaccine efficacy

Recent research shows that attenuated in vivo phenotypes may not necessarily correlate with reduced viral replication , highlighting the importance of comprehensive assessment rather than relying on a single metric of viral fitness.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.