Recombinant Avian metapneumovirus Major surface glycoprotein G (G)

Shipped with Ice Packs
In Stock

Description

Structure and Function

The G protein is a major surface glycoprotein of aMPV and acts as the major antigen by inducing neutralizing antibodies . The G protein is known as the most variable protein because it has sequence divergence . The length of the G protein can vary among different aMPV isolates . For example, one study generated two recombinant G variants: a full-length G gene with 585 amino acids and a truncated short G (sG) gene of 252 amino acids .

The extracellular region of the G protein acts as a heavily glycosylated, intrinsically disordered polymer .

Role in Infection and Immunity

The G protein is not essential for virus viability in vitro and in vivo, but may play a role in enhancing virus attachment specificity and immunity in a natural host . The G protein modulates innate and adaptive immune responses, which leads to incomplete immunity and promotes reinfection .

Use in Vaccines

Recombinant Newcastle Disease Virus (NDV) vaccines expressing the G protein of aMPV have been developed and evaluated as bivalent vaccine candidates . In one study, turkeys vaccinated with recombinant viruses expressing the G protein were completely protected against velogenic NDV challenge and partially protected against homologous pathogenic aMPV challenge . These results suggest that the aMPV G protein is a weak antigen, and other immunogenic components of the virus may be needed to improve vaccine efficacy against aMPV infections .

Genetic Variability

The G gene shows genetic variation in length among different aMPV isolates . The G sequences can be divided into subgroups with varying amino acid identity . Despite diversity between subgroups, the G protein is conserved within lineages over time, suggesting functional constraints on diversity .

Research Findings

  • Attenuation: aMPV G variants were attenuated and caused little to no disease signs in SPF turkeys .

  • Immunogenicity: aMPV G variants were immunogenic and induced a slightly different level of antibody response .

  • Protection: Expressing the F or G protein as a vaccine antigen conferred only partial protection in homologous challenged turkeys .

Table 1: Viral RNA shedding from trachea following homologous aMPV-A or -B challenge

GroupDPC 5DPC 7DPC 9
Control100%100%100%
rLS/aMPV-A G vaccinatedNDND50%
rLS/aMPV-B G vaccinatedNDND70%

Note: DPC = Days Post-Challenge; ND = Not Done

Figure 1: Mean clinical sign scores of vaccinated turkeys after challenge with aMPV-A or -B

Turkey poults were vaccinated with rLS/aMPV-A G, rLS/aMPV-B G, or PBS, and challenged by direct contact transmission with the pathogenic aMPV-A or -B virus, correspondingly, at 14 days post-vaccination. The birds were examined daily for clinical signs and the mean scores from each group of birds were plotted.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a useful reference for your own protocols.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If a particular tag type is required, please inform us, and we will prioritize its development.
Synonyms
G; Major surface glycoprotein G; Attachment glycoprotein G; Membrane-bound glycoprotein; mG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-585
Protein Length
full length protein
Species
Avian metapneumovirus (isolate Canada goose/Minnesota/15a/2001) (AMPV)
Target Names
G
Target Protein Sequence
MEVKVENVGKSQELKVKVKNFIKRSDCKKKLFALILGLVSFELTMNIMLSVMYVESNEAL SLCRIQGTPAPRDNKTNTENTKKETTFHTTTTTRDPEVRETKTTKPKTNEGATSPSRNLT TKGDIHQTTRATTEAELEKQSKQTIEPDTSTKKHTPTRPSSESPTTTQATAQLTTPTAPK ASIAPKNRQATTKKTETGTTTTSRAKKTNNPTETATTTLKATTETGKGKEGPTQHTIKEQ PETTAGETTTPQSRRTTSRPAPTTKTEEEAETTKTRTTKSTQTSTGPPGPTRSTPSKTAT ENNKRTTTIKRPNTANTDSRQQTRTTAEQDRQIQTKAKPTTNGAHAQTTTTPEHNTDTTN STKESSKEDKTTRDPSSKTPTDQEDASKGTTAANPRKNTEANTRTPPTTTPTRHTTESAT STTGDKTKAKTTRWKSTADRQPIRNSTTAETKTAQSKQPTPKQLSNNTTPENTTPPNNKS SSQTDAAPTEEIEIRSSLWRRRYVYGPCRENVLEHPMNPCFKDNTTWIYSDNGRNLPAGY YDSKTDKIICYGIYRGNSYCYGRIECTCKNGTGLLSYCCNSYNWS
Uniprot No.

Target Background

Function
This protein mediates attachment of the virion to the host cell membrane, initiating infection. Unlike other paramyxovirus attachment proteins, it lacks neuraminidase and hemagglutinating activities.
Database Links

KEGG: vg:5075783

Protein Families
Metapneumoviruses glycoprotein G family
Subcellular Location
Virion membrane. Host cell surface.

Q&A

What is the structure and function of aMPV glycoprotein G?

The glycoprotein G (G protein) of avian metapneumovirus primarily functions in viral attachment to host cell surface receptors to initiate infection. Structural analysis has revealed that the G protein's ectodomain is partitioned into a long intrinsically disordered region and a short ordered region . This structural organization likely provides flexibility for receptor binding while maintaining specific interaction domains.

Interestingly, G deletion or truncation mutants remain viable in cell cultures but show attenuated pathogenicity in SPF turkeys and induce weaker immune responses than wild-type virus . This indicates that while G protein is important for optimal infectivity and immunogenicity, it is not absolutely essential for viral replication in vitro.

Methodological approach: To study G protein structure, researchers should employ both computational methods (PONDR scoring for identifying disordered regions) and experimental approaches such as circular dichroism or nuclear magnetic resonance spectroscopy for structural characterization.

How does the G gene size vary among aMPV isolates?

Significant size variation has been documented in the G gene of aMPV, particularly in subtype C (aMPV-C). Early domestic turkey isolates of aMPV-C possessed a G gene of 1,798 nucleotides encoding a predicted protein of 585 amino acids and showed high genetic similarity to aMPV-C isolated from Canada geese . This large G gene becomes truncated upon serial passages in Vero cell cultures through deletion of 1,015 nucleotides near the end of the open reading frame .

More recent domestic turkey isolates of aMPV-C contain a smaller G gene of only 783 nucleotides, regardless of cell culture passage levels . In some cultures, both large and small genes were detected, indicating the existence of mixed virus populations within a sample .

Methodological approach: When studying G gene size variation, researchers should implement both standard and long-range PCR techniques, followed by sequencing to accurately characterize the full gene length. Next-generation sequencing approaches can help identify minor variants within a viral population.

What are the different subtypes of aMPV and how do their G proteins differ?

Avian metapneumovirus exists in multiple subtypes, with subtypes A, B, and C being the most extensively studied . These subtypes show significant variation in their G proteins, contributing to their antigenic differences. The G protein of subtype C (aMPV-C) has been particularly well-characterized, with complete genome sequences now available from wild birds in Europe .

G protein amino acid sequences from aMPV-C variants isolated from wild mallards showed a high degree of variability compared to domestic poultry isolates . In Colombia, aMPV subtype B was identified in commercial poultry and wild birds, with sequencing revealing high genetic similarity to vaccine strains .

Methodological approach: Researchers should employ comparative genomics using multiple sequence alignments and phylogenetic analysis to identify conserved domains and subtype-specific regions, particularly when designing subtype-specific detection methods or vaccines.

What mechanisms drive G gene truncation in aMPV?

The truncation of the G gene in aMPV represents an important evolutionary mechanism. Serial passage of aMPV-C in Vero cell cultures leads to deletion of 1,015 nucleotides near the end of the G gene open reading frame . Similarly, natural passage in turkeys in the field appears to have led to truncation of the G gene, suggesting this may be a mechanism of virus evolution for survival in new hosts or environments .

The specific molecular mechanisms driving this truncation are not fully understood but may involve selection pressure for more efficient replication in certain environments. The truncated G protein may provide replication advantages in some contexts while reducing immunogenicity.

Methodological approach: To study truncation mechanisms, researchers should establish long-term serial passage experiments with regular sequencing checkpoints, and compare selection pressures in different cell types representing various host species.

How does G protein contribute to cross-species transmission of aMPV?

Evidence suggests that wild birds may serve as reservoirs and spreaders of aMPV. Studies have identified aMPV-C in wild, healthy mallards (Anas platyrhynchos), with phylogenetic analysis showing that these viruses share close sequence identity (97%) with Eurasian lineage aMPV-C strains identified in Muscovy ducks in China . This indicates potential for cross-species transmission between wild and domestic birds.

The G protein likely plays a role in host adaptation and cross-species transmission, possibly through its interaction with host cell receptors. The high variability observed in G protein sequences may facilitate adaptation to different avian species.

Methodological approach: Researchers should conduct receptor binding studies comparing G proteins from different host species, and design experimental transmission studies between wild and domestic birds with G-modified viruses to assess the protein's specific role in cross-species jumps.

What is the role of intrinsically disordered regions in G protein function?

PONDR scoring of the G protein has revealed that the ectodomain of aMPV-C is partitioned into a long intrinsically disordered region and a short ordered region . This structural organization provides important insights into aMPV G protein biology.

Intrinsically disordered regions often contribute to protein function through:

  • Increased binding flexibility with multiple partners

  • Ability to undergo conformational changes during receptor interaction

  • Potential to evade immune recognition through structural variability

Methodological approach: To investigate the functional significance of these disordered regions, researchers should conduct site-directed mutagenesis to introduce order-promoting or disorder-promoting mutations, followed by virus binding assays and pathogenicity studies.

What expression systems have been successful for aMPV G protein?

Several expression systems have been successfully used to produce recombinant aMPV G protein. One effective approach has been the use of Newcastle disease virus (NDV) LaSota vaccine strain as a vector to express the G protein of aMPV subtypes A and B . The resulting recombinant viruses (rLS/aMPV-A G and rLS/aMPV-B G) successfully expressed the G protein as detected by immunofluorescence .

Additionally, researchers have used recombinant aMPV-C as an expression vector itself. For example, recombinant aMPV-C viruses expressing the HA protein of H9N2 avian influenza virus were constructed by inserting the gene into the aMPV-C genome using a reverse genetic system .

Methodological approach: When selecting an expression system, researchers should consider:

  • Post-translational modification requirements, particularly glycosylation

  • Expression levels needed for the specific application

  • Safety profile of the expression system, especially for vaccine development

  • Stability of the expressed protein in the chosen system

How can reverse genetics be applied to generate recombinant aMPV with modified G proteins?

Reverse genetics systems have been successfully employed to generate recombinant aMPV with modified G proteins. This approach involves constructing full-length cDNA clones encoding the complete anti-sense genome of the virus, with modifications to the G gene .

The typical methodological workflow includes:

  • PCR amplification of viral genome segments

  • Site-directed mutagenesis or gene insertion to modify the G gene

  • Assembly of the complete modified genome in a plasmid vector

  • Co-transfection of the genomic plasmid with supporting plasmids encoding viral polymerase components

  • Recovery and amplification of recombinant virus

  • Verification of genetic modifications by sequencing

For example, researchers generated NDV LaSota vaccine strain-based recombinant viruses expressing the G protein of aMPV subtypes A or B using this technology . The insertion of the transcription "cassettes" containing the G gene ORF increased the length of the recombinant clones by 1338 and 1410 nucleotides respectively .

What are the biological characteristics of recombinant viruses expressing aMPV G protein?

Recombinant viruses expressing aMPV G protein show distinct biological characteristics that must be characterized for research and vaccine applications. When NDV LaSota was used as a vector for aMPV G protein expression, the recombinant viruses appeared slightly attenuated in day-old chickens with a lower ICPI (0.0) than the parental LaSota strain .

Methodological approach: Comprehensive characterization of recombinant viruses should include:

  • In vitro growth kinetics in relevant cell lines

  • Virus stability assessment through serial passage

  • Pathogenicity testing using established indices (MDT, ICPI)

  • Expression verification through immunofluorescence or Western blotting

  • In vivo replication dynamics in target species

Why is the G protein considered a weak antigen in aMPV vaccine design?

The G protein of aMPV is considered a weak antigen based on several experimental observations. In vaccine studies using recombinant NDV expressing the G protein of aMPV-A or B, vaccinated turkeys showed only partial protection against homologous aMPV challenge and lacked detectable aMPV G protein-specific antibody responses despite being completely protected against NDV challenge .

Several factors may contribute to this weak antigenicity:

  • The intrinsically disordered regions in the G protein's structure may limit stable epitope presentation

  • High sequence variability among isolates may reduce cross-protection

  • Propensity for truncation may affect epitope stability

Methodological approach: When investigating G protein immunogenicity, researchers should:

  • Compare immune responses to different forms of G protein (full-length versus truncated)

  • Evaluate multiple immunization strategies

  • Test adjuvant formulations that might enhance G protein immunogenicity

  • Assess both humoral and cell-mediated immune responses

What combination of viral proteins provides optimal protection against aMPV?

Research suggests that a combination of aMPV proteins, rather than G protein alone, is necessary for optimal vaccine protection. Studies with recombinant NDV expressing only the G protein of aMPV-A or B provided partial protection against homologous aMPV challenge, with vaccinated birds showing milder clinical signs and less virus shedding than control groups .

Research indicates that co-expression of two or more major structural proteins of aMPV, such as the F, G, and/or M proteins, may be necessary to induce enhanced protective immunity . The F (fusion) protein, in particular, is thought to be a more immunogenic component that could complement the G protein in vaccine formulations.

Methodological approach: When developing multi-protein vaccines, researchers should:

  • Design expression systems capable of co-expressing multiple viral proteins

  • Evaluate additive or synergistic effects through challenge studies

  • Assess both neutralizing antibody responses and cellular immunity

  • Compare protection against homologous and heterologous subtypes

How effective are recombinant viruses expressing aMPV G protein as vaccines?

The efficacy of recombinant viruses expressing aMPV G protein as vaccines has been assessed in several studies. When turkeys were vaccinated with recombinant NDV expressing aMPV-A G or aMPV-B G, they were completely protected against challenge with velogenic NDV but only partially protected against homologous pathogenic aMPV challenge .

At 9 days post-challenge with pathogenic aMPV-A or -B, the recombinant virus-vaccinated turkeys showed milder clinical signs and reduced virus shedding compared to control groups . Specifically, viral RNA shedding from the trachea was reduced, with 50% and 70% of the vaccinated birds negative for aMPV-A and aMPV-B viral RNA, respectively, while 100% of control birds remained positive .

This table summarizes the protection efficacy of recombinant vaccines:

VaccineProtection against NDVProtection against aMPVaMPV Viral Shedding at 9 DPC
rLS/aMPV-A GComplete (100%)Partial50% negative
rLS/aMPV-B GComplete (100%)Partial70% negative
ControlNoneNone0% negative

Methodological approach: Vaccine efficacy studies should employ:

  • Challenge with virulent strains via natural transmission routes

  • Comprehensive clinical scoring systems

  • Viral load quantification in relevant tissues

  • Serological testing for antibody responses to each viral component

What are the optimal cell culture systems for studying aMPV G protein?

The selection of appropriate cell culture systems is crucial for studying aMPV G protein. Vero cells have been widely used for propagating aMPV, although these cells can influence virus evolution, particularly causing truncation of the G gene upon serial passages .

Other cell lines successfully used include:

  • DF-1 (chicken fibroblast) cells, which support growth of recombinant NDV expressing aMPV G protein

  • HEp-2 cells, used for transfection during rescue of recombinant viruses

  • SPF chicken embryonated eggs for virus amplification

Methodological approach: When selecting a cell culture system, researchers should consider:

  • The specific research question (viral replication, protein expression, host interaction)

  • The subtype of aMPV being studied

  • The need to minimize adaptive mutations

  • For studies focused on natural host interactions, primary turkey or chicken respiratory epithelial cells may provide more relevant biological insights

How can experimental design address G protein's high variability?

The high variability of aMPV G protein, particularly in wild bird isolates , presents significant challenges for research and vaccine development. Experimental designs must account for this variability through several approaches:

  • Comprehensive sequence analysis of field isolates to identify conserved and variable regions

  • Inclusion of multiple G protein variants in comparative studies

  • Focus on conserved functional domains when designing broadly protective vaccines

  • Regular monitoring of circulating strains to detect emerging variants

Methodological approach: Researchers should implement longitudinal surveillance studies of both domestic and wild birds, with full G gene sequencing and phylogenetic analysis to track evolution and identify conserved targets for intervention.

What methods can detect wild birds as potential reservoirs of aMPV?

Wild birds have been identified as potential reservoirs for aMPV. A study that screened 1323 oropharyngeal and cloacal swab samples from wild mallards in the Netherlands identified aMPV-C infections in healthy wild birds . Detection methodologies included:

  • RT-PCR using degenerate primer pairs to detect all members of the Paramyxoviridae and Pneumoviridae families

  • aMPV-C-specific RT-qPCR assays

  • Next-generation sequencing for complete genome characterization

  • Phylogenetic analysis to understand the relationship between wild bird isolates and poultry strains

When seven cases of aMPV-C infections were identified in wild mallards, two were further processed using next-generation sequencing, revealing that they shared 97% sequence identity with Eurasian lineage aMPV-C strains identified in Muscovy ducks in China .

Methodological approach: Surveillance studies should:

  • Include both oropharyngeal and cloacal sampling

  • Employ molecular methods with broad detection capabilities

  • Conduct regular sampling at migratory bird hotspots

  • Perform full genome sequencing of positive samples to track transmission

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.