Recombinant Avian metapneumovirus Small hydrophobic protein

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

The Recombinant Avian metapneumovirus Small Hydrophobic (SH) Protein is a genetically engineered version of the SH protein encoded by avian metapneumovirus (aMPV), a respiratory pathogen affecting poultry. The SH protein is one of three glycoproteins in the aMPV genome, alongside the fusion (F) and attachment (G) proteins. Recombinant SH protein is primarily used for diagnostic and research purposes to study viral pathogenesis, immune responses, and antigenic diversity .

Key Features

PropertyDetails
Gene SourceaMPV subgroup C (APV/C)
Amino Acid Length175 residues
Molecular Weight31–38 kDa (glycosylated form)
Expression SystemBaculovirus-infected insect cells or E. coli
Post-Translational ModificationsFour potential glycosylation sites .

The SH protein’s sequence (e.g., MEPLKVSGSGGIPMKTRLNIILEKSINKILIILGLLLIASTVITITLTVEYIRVENELQL...) includes a hydrophobic transmembrane domain critical for oligomerization and membrane interaction .

Functional Roles

  • Membrane Permeability Modulation: The SH protein alters cellular membrane permeability, a hallmark of viroporins. This activity facilitates viral replication by disrupting ion gradients .

  • Fusion Protein Regulation: SH inhibits the fusogenic activity of the F protein, potentially controlling the timing of membrane fusion during infection .

  • Subgroup Specificity: The aMPV/C SH protein shares only 24% amino acid identity with human metapneumovirus (hMPV) SH and no discernible homology with aMPV/A or aMPV/B SH, making it a subgroup-specific antigen .

Immunogenicity and Diagnostic Utility

  • Recombinant SH protein elicits antibodies specific to aMPV/C but shows no cross-reactivity with aMPV/A, aMPV/B, or hMPV antisera .

  • Used in ELISA-based assays to differentiate aMPV/C infections from other subtypes, with 90% specificity in turkey sera .

Table 1: Diagnostic and Research Applications

ApplicationMethodologyOutcome
Serological DifferentiationRecombinant SH-based ELISADistinguishes aMPV/C from hMPV and other aMPV subtypes .
Antigenic CharacterizationWestern blot with monoclonal antibodiesConfirms SH protein expression and glycosylation status .
Pathogenesis StudiesDeletion mutants (in vitro and in vivo)SH-deficient aMPV shows reduced replication in turkeys .

Challenges and Limitations

  • Low Antibody Titers: Recombinant SH protein alone does not induce high neutralizing antibody titers compared to whole-virus vaccines .

  • Structural Complexity: Glycosylation patterns vary between expression systems (e.g., baculovirus vs. E. coli), affecting antigenic consistency .

Future Directions

  • Vaccine Development: Engineering SH as a multivalent antigen alongside F or G proteins to enhance immunogenicity .

  • Host Adaptation Studies: Investigating SH’s role in interspecies transmission, given its homology with hMPV .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for customers.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: While the tag type is determined during production, please specify your requirements for preferential development of a specific tag.
Synonyms
SH; Small hydrophobic protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-175
Protein Length
full length protein
Species
Avian metapneumovirus (isolate Canada goose/Minnesota/15a/2001) (AMPV)
Target Protein Sequence
MEPLKVSGSGGIPMKTRLNIILEKSINKILIILGLLLIASTVITITLTVEYIRVENELQL CKMGAEVAKTTLEPPAQPTKTTPTLTSTRSTTATFKTRPVSRTNHHTNPSCWREEEKCQN ITAKWSNCFGTFLPVRVNCTVLRELCDEQLGNHTTVQVSKRCTCIYALNWDCSYA
Uniprot No.

Target Background

Function
This viroporin forms an ion channel exhibiting likely low ion selectivity. It counteracts host innate immunity by inhibiting TLR7/MyD88/TRAF6 signaling and STAT1 phosphorylation, resulting in downregulation of type-I IFN.
Database Links

KEGG: vg:5075779

Protein Families
Pneumovirinae small hydrophobic protein family
Subcellular Location
Virion membrane; Single-pass type II membrane protein. Host cell membrane; Single-pass type II membrane protein.

Q&A

What is the Small Hydrophobic protein of Avian Metapneumovirus and where does it fit in the viral genome?

The Small Hydrophobic (SH) protein is one of eight proteins encoded by the Avian Metapneumovirus (AMPV) genome. AMPV contains a negative-sense, unsegmented linear RNA genome (approximately 13.3-14 kb) with genes arranged in the order: 3′-leader-N-P-M-F-M2-SH-G-L-trailer-5′ . The SH protein functions as a small type II integral membrane protein that gets incorporated into virions. It's classified as a viroporin involved in membrane permeability and is only found in certain paramyxoviruses . The APV/C SH gene specifically is 525 nucleotides in length and encodes a polyprotein of 175 amino acids with four potential glycosylation sites .

How does the SH protein differ between AMPV subtypes?

The SH protein demonstrates remarkable variability between AMPV subtypes, making it an ideal candidate for differential diagnostics. Sequence analysis reveals that the APV/C SH protein has very low (24%) amino acid identity with the corresponding protein of human metapneumovirus (hMPV) and no discernible identity with the SH protein of APV/A or APV/B . This extreme sequence divergence is consistent with the broader antigenic differences observed between AMPV subtypes, particularly in the envelope glycoproteins (SH, G, and F) . These molecular differences explain why antibodies specific to one subtype may not recognize SH proteins from other subtypes.

What expression systems are most effective for producing recombinant AMPV SH protein?

The baculovirus expression system has proven most effective for producing recombinant AMPV SH protein with properties similar to its native counterpart. When using this system:

  • The recombinant baculovirus containing the SH gene is used to infect insect cells

  • These infected cells produce a 31- to 38-kDa glycosylated form of the SH protein

  • The expressed protein maintains appropriate posttranslational modifications

  • The resulting protein demonstrates stability even after multiple freeze-thaw cycles

The baculovirus system offers several advantages over bacterial expression systems:

  • Insect cells provide appropriate posttranslational modification of expressed proteins

  • They demonstrate the ability for membrane protein secretion

  • Unlike E. coli-based systems, they do not contain excessive lipopolysaccharide that often contaminates recombinant proteins

What methodological approaches ensure proper glycosylation of recombinant SH protein?

Proper glycosylation of the AMPV SH protein requires careful consideration of the expression system and culture conditions. The recombinant SH protein contains four potential N-linked glycosylation sites, which explains its migration pattern on SDS-PAGE as a broad band between 31-38 kDa .

To ensure proper glycosylation:

  • Select insect cell lines (such as Sf9 or High Five) that possess appropriate glycosylation machinery

  • Optimize infection conditions including multiplicity of infection (MOI), cell density at infection, and harvest time

  • Maintain consistent culture conditions throughout production

  • Validate glycosylation status using glycosidase treatments (PNGase F or Endo H) followed by Western blot analysis to confirm N-linked glycan modifications

The broad gel migration pattern observed with baculovirus-expressed APV/C SH protein reflects differential usage of these glycosylation sites during posttranslational modification in insect cells .

What are the key biochemical properties of the recombinant SH protein that influence its stability and functionality?

The recombinant AMPV SH protein demonstrates several key biochemical properties:

  • Glycosylation status: The SH protein undergoes N-linked glycosylation at multiple sites, producing a heterogeneous population with molecular weights ranging from 31-38 kDa .

  • Dimer formation: Glycosylated AMPV SH proteins form homodimers through cysteine-mediated disulfide bonds, a characteristic not previously reported for SH proteins of paramyxoviruses . This dimerization may be crucial for its functional activity.

  • Membrane topology: As a type II integral membrane protein, the SH protein has a specific orientation within cellular membranes that affects its functionality and interactions with other viral and cellular components .

  • Extracellular release: The SH protein can be released into the extracellular environment, suggesting potential roles beyond its function as a membrane-bound viroporin .

  • Stability: Unlike some baculovirus-expressed proteins, the recombinant APV/C SH protein demonstrates remarkable stability and homogeneity even after several freeze-thaw cycles . This stability is crucial for its potential application as a diagnostic reagent.

How does the structure-function relationship of AMPV SH protein compare with SH proteins from other pneumoviruses?

The AMPV SH protein shares limited structural similarity with SH proteins from other pneumoviruses, yet maintains some functional parallels:

FeatureAMPV SHhMPV SHFunctional Implication
Amino acid identityBase reference24% identity with AMPV/CLimited cross-reactivity between antibodies
GlycosylationN-linked glycosylation at 4 potential sitesDifferent glycosylation patternAffects protein folding, stability, and antigenicity
DimerizationForms homodimers via disulfide bondsNot reported for homodimer formationMay impact membrane permeability function
Membrane topologyType II integral membrane proteinType II integral membrane proteinSimilar membrane integration mechanism
Viroporin activityFunctions as a viroporinFunctions as a viroporinShared role in viral replication cycle

Unlike structural proteins with highly conserved sequences (such as nucleocapsid and matrix proteins), the SH protein demonstrates significant variation between viral subtypes, making it an ideal candidate for differential diagnosis .

How can recombinant SH protein be utilized for developing subtype-specific diagnostic assays?

The recombinant SH protein offers exceptional potential for subtype-specific AMPV diagnostics due to its high antigenic specificity. The methodological approach includes:

  • ELISA development: Using purified recombinant SH protein as the capture antigen, an enzyme-linked immunosorbent assay can be developed to detect subtype-specific antibodies in turkey serum. Western blot analysis has shown that the expressed recombinant SH protein is recognized only by APV/C-specific antibodies, not by antibodies for APV/A, APV/B, or hMPV .

  • Standardization protocol:

    • Coat microplates with purified recombinant SH protein at optimized concentration

    • Block non-specific binding sites

    • Apply diluted test serum samples

    • Detect bound antibodies using enzyme-conjugated secondary antibodies

    • Develop and measure the colorimetric reaction

  • Validation approach: Test the assay with known positive and negative serum samples from experimentally infected birds, ensuring no cross-reactivity with antisera raised to APV/A, APV/B, and hMPV .

This approach provides a more specific alternative to using the matrix (M) protein, which shares 78% and 77% amino acid identity with APV/A and APV/B respectively, limiting its usefulness for subtype-specific detection .

What technical challenges might researchers encounter when working with recombinant SH protein and how can they be addressed?

Researchers working with recombinant AMPV SH protein may encounter several technical challenges:

  • Protein solubility: As a hydrophobic membrane protein, the SH protein may have solubility issues during purification. This can be addressed by:

    • Using appropriate detergents during extraction and purification

    • Optimizing buffer conditions to maintain protein stability

    • Considering fusion tags that enhance solubility while not affecting antigenicity

  • Heterogeneous glycosylation: The variable usage of glycosylation sites results in a heterogeneous protein population (31-38 kDa) . To address this:

    • Use glycosidase treatments to remove glycans if homogeneity is required

    • Employ size exclusion chromatography to separate different glycoforms if necessary

    • Validate that glycosylation heterogeneity doesn't impact the intended application

  • Dimerization management: The cysteine-mediated disulfide bonds forming homodimers may complicate certain analyses. Solutions include:

    • Including reducing agents when monomeric forms are required

    • Optimizing conditions to stabilize either dimeric or monomeric forms depending on research needs

    • Designing experiments to account for the natural dimeric state

  • Antigenic stability: Ensuring the recombinant protein maintains its antigenic properties over time requires:

    • Proper storage conditions (temperature, buffer composition)

    • Regular quality control testing using reference antibodies

    • Validation of activity after each freeze-thaw cycle

How might the SH protein contribute to AMPV pathogenesis and what experimental designs could test these hypotheses?

The SH protein likely contributes to AMPV pathogenesis through multiple mechanisms, though its precise roles remain to be fully elucidated. Based on its properties as a viroporin and membrane-associated protein, several hypotheses and experimental approaches warrant investigation:

  • Membrane permeability hypothesis: As a viroporin, SH may alter host cell membrane permeability, affecting ion homeostasis and promoting viral replication.

    • Experimental approach: Measure ion flux in cells expressing recombinant SH protein compared to controls using fluorescent indicators or patch-clamp techniques

    • Compare wild-type virus with SH-deleted mutants in vitro and in vivo

  • Immune modulation hypothesis: SH may interfere with host immune responses, potentially by affecting cytokine signaling pathways.

    • Experimental approach: Assess cytokine production in cells expressing SH protein

    • Evaluate immune cell recruitment and activation in tissues infected with wild-type versus SH-deleted viruses

  • Viral assembly and budding hypothesis: The dimeric structure of SH might play a role in viral assembly or budding.

    • Experimental approach: Perform co-immunoprecipitation studies to identify SH protein interaction partners

    • Use super-resolution microscopy to visualize SH localization during viral assembly

  • Host range determination: The substantial sequence variation between subtypes might contribute to host specificity.

    • Experimental approach: Compare receptor binding and viral entry efficiency in cells from different host species

    • Conduct cross-species infection studies with chimeric viruses containing SH proteins from different subtypes

What methodological considerations are important when investigating the topology and cellular localization of the SH protein?

Investigating the topology and cellular localization of the AMPV SH protein requires sophisticated methodological approaches:

  • Membrane topology determination:

    • Protease protection assays: Treat intact cells or membrane fractions with proteases to cleave exposed protein domains

    • Glycosylation mapping: Introduce artificial glycosylation sites at various positions and assess which sites become glycosylated

    • Immunofluorescence using antibodies against different domains under permeabilized and non-permeabilized conditions

    • FRET-based approaches to measure proximity of different protein domains to membrane surfaces

  • Subcellular localization studies:

    • Confocal microscopy with co-localization markers for different cellular compartments

    • Immunogold electron microscopy for high-resolution localization

    • Cell fractionation followed by Western blotting to identify compartment-specific enrichment

    • Live-cell imaging using fluorescently-tagged SH protein to track movement between compartments during infection

  • Protein-protein interaction analysis:

    • Proximity labeling techniques (BioID, APEX) to identify proteins in the vicinity of SH

    • Co-immunoprecipitation followed by mass spectrometry to identify interacting partners

    • Split-GFP complementation assays to visualize interactions in living cells

    • Yeast two-hybrid screening to identify potential host cell factors interacting with SH

  • Temporal dynamics investigation:

    • Time-course experiments tracking SH localization throughout the viral replication cycle

    • Pulse-chase experiments to monitor protein trafficking

    • Drug interventions targeting specific cellular pathways to determine dependencies

These methodological approaches would build upon existing topology studies and provide a comprehensive understanding of SH protein behavior in infected cells.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.