Recombinant Avian nephritis virus 1 Non-structural polyprotein 1AB (ORF1)

Shipped with Ice Packs
In Stock

Description

Introduction to Avian Nephritis Virus 1

Avian Nephritis Virus 1 (ANV-1) belongs to the Avastroviridae family and is associated with significant economic losses in the poultry industry. The virus causes avian nephritis, a disease characterized by diarrhea, retarded growth, tubulonephrosis, and mortality rates of 2-6% in affected flocks . As a member of avian astroviruses, ANV-1 features a single-stranded positive-sense RNA genome approximately 6,927 nucleotides in length, excluding the poly(A) tail . The virus has been detected in chickens of various ages, primarily between 4 to 22 days old, and has been documented across multiple geographical regions .

Clinical Significance

ANV-1 infection manifests primarily through renal pathology, with affected birds showing clinical signs including growth retardation, runting-stunting syndrome, and diarrhea. Histopathological examination typically reveals tubulonephrosis, interstitial nephritis, and in severe cases, uricosis or gout . These findings underscore the economic impact of ANV-1 infections on commercial poultry operations worldwide.

Taxonomic Classification

ANV-1 is classified within the Avastroviridae family, which is divided into multiple genotypes. Currently, three known serotypes of ANV exist (ANV-1, -2, and -3), as designated by indirect immunofluorescence and virus neutralization assays . The high level of genetic diversity observed in ANV strains results from both genetic drift through point mutations and genetic shift through recombination mechanisms, creating challenges for classification and serotyping .

Genomic Structure and Organization of ANV-1

The ANV-1 genome consists of 6,927 nucleotides organized into three sequential open reading frames (ORFs), designated as ORF1a, ORF1b, and ORF2, flanked by untranslated regions at both 5' and 3' ends . This genomic organization is characteristic of members of the Astroviridae family.

General Genome Organization

The ANV-1 genome begins with a short 5' untranslated region (UTR) of approximately 13 nucleotides, followed by the three main coding regions, and concludes with a 3' UTR of about 305 nucleotides and a polyadenylated tail . The genomic RNA serves as the template for viral replication and protein synthesis. Two major RNA species have been detected in ANV-infected cells: genomic RNA (approximately 7.5 kb) and subgenomic RNA (approximately 3.0 kb) .

Open Reading Frame Structure

The arrangement of the three ORFs in the ANV-1 genome follows a specific pattern:

Genomic RegionNucleotide PositionLength (nt)Function
5' UTR1-1313Regulatory functions
ORF1a14-30283,027Encodes polyprotein with serine protease
ORF1a-1b overlap3019-302810Ribosomal frameshifting
ORF1b3019-45481,530Encodes RNA-dependent RNA polymerase
ORF1b-2 overlap4472-454877Regulatory region
ORF24472-66192,148Encodes structural proteins
3' UTR6620-6927305Regulatory functions

This genomic organization represents a total genome length of 6,927 nucleotides, excluding the poly(A) tail . The table highlights the partially overlapping nature of the reading frames, which is a characteristic feature of astroviruses.

ORF1a and ORF1b Expression

ORF1a (nucleotides 14 to 3028) encodes a polypeptide of 1,005 amino acids, while ORF1b (nucleotides 3019 to 4548) encodes a polypeptide of 483 amino acids . The two ORFs overlap by 10 nucleotides, with ORF1b in reading frame +1 relative to ORF1a. This arrangement facilitates a ribosomal frameshifting mechanism for the expression of the complete polyprotein 1AB .

Ribosomal Frameshifting Mechanism

A crucial aspect of ORF1 expression involves a ribosomal frameshift signal located in the overlapping region between ORF1a and ORF1b. This signal consists of a "shifty" heptanucleotide sequence (AAAAAAC) from nucleotides 3022 to 3028, followed by a stem-loop structure from nucleotides 3035 to 3052 . This arrangement allows for the production of polyprotein 1AB through a -1 ribosomal frameshift mechanism, similar to that observed in other astroviruses .

Functional Domains and Motifs

The ORF1a-encoded portion of polyprotein 1AB contains a serine protease motif that plays a crucial role in the proteolytic processing of viral proteins . Additionally, this region includes a nuclear localization bipartite signal motif (NLS) . The ORF1b-encoded portion contains the RNA-dependent RNA polymerase (RdRp) domain essential for viral genome replication . The complete polyprotein undergoes autocatalytic cleavage to generate multiple non-structural proteins that assemble into the viral replication-transcription complex.

Recombinant Production and Characterization

Recombinant expression systems have enabled the production and characterization of ANV-1 non-structural polyprotein 1AB and its components, facilitating detailed studies of its structure and function.

Expression Systems and Methods

Recombinant ANV-1 non-structural polyprotein 1AB, or portions thereof, can be expressed in bacterial systems such as E. coli. For example, a recombinant fragment corresponding to amino acids 955-1512 of the non-structural polyprotein 1AB has been successfully expressed with an N-terminal His tag . The expression in E. coli provides a convenient system for producing large quantities of the protein for research purposes.

Protein Characteristics

The recombinantly expressed ANV-1 non-structural polyprotein 1AB fragment (amino acids 955-1512) exhibits the following characteristics:

CharacteristicDescription
SourceExpressed in E. coli
TagN-terminal His tag
Protein LengthFragment corresponding to amino acids 955-1512
FormLyophilized powder
Purity>90% as determined by SDS-PAGE
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionIn deionized sterile water to 0.1-1.0 mg/mL
UniProt IDQ9JGF2

The amino acid sequence of this recombinant fragment is: "QQPQQPVVEEKKRTPPPKPQRKPKTGAKAKCLDCGETFVERQDFHVCKSKKLNEPPSGGYTPVPDHLRWNNWQIYMEPLDLRITVPENYPILGHIAIDKLVERKKKVNDPLLKMLEQPKCEGFTSTTWTRKAYTKSFEKFDYGDAVDFVQDYPELTAFADAAVLAEVGYMEGTHVIPIQETSKNMDSTPAFPKMLDFDSERDYLEAHGMKEYIDTQLGVQSGKPLWWCFLKNEILKEKKSEDDIRIITCSDPVITRLGASFDSEQNERMKERTETHHAQVGWTPFFGGLDKRVRRITSCGRTQVLELDWTRFDGTIPVQLFQRMRELRKFFLTRRSRRRYGKLLDWYNAQLTDRITLLPTGEVTHVKKGNPSGQFSTTVDNNLVNEWLTAFEFGYQHLENHGIIPTVRDYRANVDFLCYGDDRLLAFNPSFVNYDPQVTIDMYKNIFGMWVKPENIKLFDSPTGSSFCGFTLVKPHGQWVGVVNVNKLLQSLKTPTRRLPDLESLWGKLVSLKIMCYHSDPEAVSYLSNQIRRVEEYARAEG" .

Research Applications and Significance

The recombinant ANV-1 non-structural polyprotein 1AB has several important applications in virology research and potential applications in vaccine development and diagnostic tests.

Structure-Function Studies

Recombinant ANV-1 non-structural polyprotein 1AB enables detailed investigations of the protein's structure and function. By expressing individual domains or fragments, researchers can study the specific roles of different regions in viral replication, including the mechanisms of proteolytic processing, RNA binding, and polymerase activity. Such studies contribute to our understanding of the fundamental biology of astroviruses.

Comparative Virology

The high diversity observed among ANV strains, including variations in the non-structural polyprotein 1AB, provides opportunities for comparative studies. Analysis of different isolates has revealed significant sequence variations regardless of origin and year of sample collection . Even samples collected from the same farm at the same time but from different flocks can differ in nucleotide and putative amino acid sequences . These variations may influence viral pathogenicity, antigenicity, and diagnostic detection.

Diagnostic Development

Recombinant viral proteins, including non-structural polyprotein 1AB fragments, can serve as valuable reagents for developing and validating diagnostic tests. These proteins can be used as antigens in serological assays or as positive controls in molecular diagnostic tests based on reverse transcriptase-polymerase chain reaction (RT-PCR) . Improved diagnostics are essential for monitoring and controlling ANV infections in poultry flocks.

Future Directions and Challenges

Despite significant advances in our understanding of ANV-1 non-structural polyprotein 1AB, several challenges and opportunities remain for future research.

Complete Functional Characterization

While the general functions of the non-structural polyprotein 1AB have been established, detailed characterization of its enzymatic activities, interaction partners, and three-dimensional structure remains incomplete. Future studies employing advanced structural biology techniques, such as cryo-electron microscopy and X-ray crystallography, could provide valuable insights into the protein's structure and function.

Genetic Diversity and Evolution

The high genetic diversity observed among ANV strains presents challenges for vaccine development and diagnostic testing. Further research is needed to understand the impact of sequence variations in the non-structural polyprotein 1AB on viral fitness, pathogenicity, and host range. Continued surveillance and genomic characterization of circulating strains will be essential for tracking the evolution of ANV and anticipating emerging threats.

Therapeutic Applications

Understanding the structure and function of ANV-1 non-structural polyprotein 1AB could facilitate the development of targeted antiviral strategies. Since this polyprotein contains essential enzymatic activities for viral replication, it represents a potential target for antiviral drugs. The development of small-molecule inhibitors or other therapeutic approaches targeting these enzymes could provide new options for controlling ANV infections in poultry.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ORF1; Non-structural polyprotein 1AB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
955-1512
Protein Length
Full Length of Mature Protein
Species
Avian nephritis virus 1 (ANV-1)
Target Names
ORF1
Target Protein Sequence
QQPQQPVVEEKKRTPPPKPQRKPKTGAKAKCLDCGETFVERQDFHVCKSKKLNEPPSGGY TPVPDHLRWNNWQIYMEPLDLRITVPENYPILGHIAIDKLVERKKKVNDPLLKMLEQPKC EGFTSTTWTRKAYTKSFEKFDYGDAVDFVQDYPELTAFADAAVLAEVGYMEGTHVIPIQE TSKNMDSTPAFPKMLDFDSERDYLEAHGMKEYIDTQLGVQSGKPLWWCFLKNEILKEKKV SEDDIRIITCSDPVITRLGASFDSEQNERMKERTETHHAQVGWTPFFGGLDKRVRRITSC GRTQVLELDWTRFDGTIPVQLFQRMRELRKFFLTRRSRRRYGKLLDWYNAQLTDRITLLP TGEVTHVKKGNPSGQFSTTVDNNLVNEWLTAFEFGYQHLENHGIIPTVRDYRANVDFLCY GDDRLLAFNPSFVNYDPQVTIDMYKNIFGMWVKPENIKLFDSPTGSSFCGFTLVKPHGQW VGVVNVNKLLQSLKTPTRRLPDLESLWGKLVSLKIMCYHSDPEAVSYLSNQIRRVEEYAR AEGIELPEVGPDFYRKIW
Uniprot No.

Target Background

Function
This protein contains the viral protease involved in cleaving the polyprotein into functional products. It also encompasses the activities required for replicating genomic RNA and transcribing subgenomic mRNA. The protein is covalently attached to the 5' end of the genomic and subgenomic RNAs.
Protein Families
Astroviridae polyprotein 1AB family
Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is Avian Nephritis Virus 1 and how is it classified?

Avian Nephritis Virus 1 (ANV-1) is a positive-strand RNA virus that belongs to the family Astroviridae. It was initially isolated from the rectal contents of apparently normal 1-week-old broiler chickens and is associated with acute nephritis in young chickens . ANV was previously considered an enterovirus-like virus (ELV) but has been reclassified as an avian astrovirus based on complete genome sequencing and molecular analysis . ANV represents the first avian astrovirus whose genome has been completely sequenced, and it has a genome organization similar to human astroviruses but with distinct phylogenetic characteristics .

What is the genomic organization of ANV-1?

The complete RNA genome of ANV-1 is 6,927 nucleotides in length (excluding the poly(A) tail) and contains three sequential open reading frames (ORFs) :

Genome RegionNucleotide PositionLengthFunction
5' NTR1-1313 ntNon-translated region
ORF 1a14-30283,027 ntEncodes a 1,005 amino acid polypeptide with serine protease motif
ORF 1a-1b overlap3019-302810 ntContains ribosomal frameshift signal
ORF 1b3019-45481,530 ntEncodes a 483 amino acid polypeptide with RNA-dependent RNA polymerase
ORF 1b-2 overlap4472-454877 ntOverlapping region
ORF 24472-66192,148 ntEncodes a 683 amino acid polypeptide (structural proteins)
3' NTR6620-6927305 ntNon-translated region

This genomic structure is similar to human astroviruses, although sequence homology is relatively low, with the highest amino acid homology found in the ORF 1b product (41.9%) .

What are the key structural and functional characteristics of ANV-1 ORF1?

The ANV-1 ORF1 consists of two main parts:

  • ORF 1a (nucleotides 14-3028): Encodes a polypeptide of 1,005 amino acids containing a serine protease motif that is essential for viral replication .

  • ORF 1b (nucleotides 3019-4548): Encodes a polypeptide of 483 amino acids containing an RNA-dependent RNA polymerase (RdRp) domain that is critical for viral genome replication .

A notable feature is the ribosomal frameshift signal in the overlapping region between ORF 1a and 1b, consisting of a "shifty" heptanucleotide (AAAAAAC) from nucleotides 3022 to 3028, followed by a stem-loop structure from nucleotides 3035 to 3052 . This mechanism allows for the translation of a fusion protein containing both ORF 1a and ORF 1b products.

How can researchers effectively express and purify recombinant ANV-1 Non-structural polyprotein 1AB for functional studies?

For efficient expression and purification of recombinant ANV-1 Non-structural polyprotein 1AB, researchers typically employ bacterial expression systems, particularly E. coli. Based on the available data, the following methodology has proven effective:

  • Expression System Selection: E. coli is the preferred host for expressing fragments or full-length ORF1 proteins. The recombinant protein described in source was expressed in E. coli with an N-terminal His-tag for purification purposes.

  • Construct Design: When studying specific domains, researchers can focus on expressed fragments rather than the entire polyprotein. For example, the commercially available recombinant ANV-1 ORF1 protein consists of amino acids 955-1512 of the mature protein .

  • Purification Protocol:

    • Utilize affinity chromatography with Ni-NTA resin for His-tagged proteins

    • Aim for >90% purity as determined by SDS-PAGE

    • Lyophilize the purified protein in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

  • Storage Considerations:

    • Store at -20°C/-80°C upon receipt

    • Aliquot to avoid repeated freeze-thaw cycles

    • For working stocks, store aliquots at 4°C for up to one week

    • For reconstitution, use deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add 5-50% glycerol (final concentration) for long-term storage

What methods can be employed to study the ribosomal frameshifting mechanism between ORF1a and ORF1b?

The ribosomal frameshifting mechanism is a critical feature of ANV-1 gene expression. To investigate this phenomenon:

  • Mutational Analysis: Create mutations in the "shifty" heptanucleotide sequence (AAAAAAC) and the downstream stem-loop structure to assess their roles in frameshifting efficiency.

  • Reporter Assays: Develop dual-luciferase reporter constructs containing the frameshift region between two different luciferase genes to quantify frameshifting efficiency in different cell types.

  • RNA Structure Analysis: Employ chemical probing methods (SHAPE, DMS) to confirm the predicted stem-loop structure that facilitates frameshifting.

  • In vitro Translation Systems: Utilize cell-free translation systems to study the mechanics of frameshifting under controlled conditions.

  • Ribosome Profiling: Apply ribosome profiling techniques to map ribosome pausing at the frameshift site during translation.

This frameshifting mechanism is comparable to that observed in human astroviruses, which have a 70-nucleotide overlap between ORF1a and ORF1b, compared to ANV-1's 10-nucleotide overlap .

How does genetic diversity in ANV-1 ORF1 impact viral function and antigenicity?

Genetic diversity in ANV-1 ORF1 has significant implications for viral function and antigenicity:

  • Sequence Diversity: While much research has focused on capsid protein diversity, ORF1 diversity also exists. Capsid proteins of different ANV isolates can share amino acid identities as low as 51% , suggesting similar diversity may exist in ORF1.

  • Functional Conservation: Despite sequence diversity, the key functional motifs in ORF1 tend to be conserved. For example, the serine protease motif in ORF1a and the RNA-dependent RNA polymerase motifs in ORF1b show higher conservation than other regions .

  • Recombination Events: Evidence suggests that RNA recombination events occur in ANV, potentially leading to new combinations of viral genomic regions. While recombination has been documented in the capsid region , similar events may occur in ORF1, creating novel enzymatic properties.

  • Co-circulation of Diverse Strains: Studies have identified co-circulation of sequence-diverse ANVs within the same geographical locations and time periods , which may facilitate recombination events and the emergence of new variants with altered ORF1 functionality.

  • Impact on Diagnostics and Control: High sequence diversity challenges the development of broadly reactive diagnostic tests and antiviral strategies targeting ORF1 proteins.

What are the recommended methods for characterizing the enzymatic activities of ANV-1 ORF1-encoded proteins?

To characterize the enzymatic activities of ANV-1 ORF1-encoded proteins:

  • Serine Protease Activity (ORF1a):

    • Develop fluorogenic or chromogenic peptide substrates based on predicted cleavage sites

    • Perform in vitro protease assays with purified protein

    • Use site-directed mutagenesis to confirm the catalytic triad residues

    • Test protease inhibitors to characterize the enzyme's specificity

  • RNA-dependent RNA Polymerase Activity (ORF1b):

    • Establish in vitro RdRp assays using purified protein and RNA templates

    • Analyze template specificity and RNA synthesis efficiency

    • Characterize the kinetics of nucleotide incorporation

    • Assess the effect of divalent cations (Mg²⁺, Mn²⁺) on polymerase activity

  • Protein-RNA Interactions:

    • Perform electrophoretic mobility shift assays (EMSA) to study binding to viral RNA

    • Use RNA competition assays to determine binding specificity

    • Identify RNA structural elements required for recognition by viral proteins

  • Protein-Protein Interactions:

    • Investigate interactions between ORF1a and ORF1b products using co-immunoprecipitation

    • Employ yeast two-hybrid or mammalian two-hybrid systems to map interaction domains

    • Utilize biolayer interferometry or surface plasmon resonance for quantitative binding analysis

How can infectious cDNA clones of ANV-1 be developed for reverse genetics studies?

Development of infectious cDNA clones provides a powerful tool for studying ANV-1 molecular biology:

  • Construction Strategy:

    • Generate genomic-length cDNA by RT-PCR from viral RNA

    • Clone the full genome into suitable vectors with appropriate promoters (e.g., T7 or CMV)

    • Incorporate unique restriction sites to facilitate subsequent mutagenesis

  • Transcription and Transfection:

    • Transcribe full-length RNA in vitro from the cDNA clone

    • Transfect the RNA into susceptible cells (e.g., chicken kidney cells)

    • Monitor for cytopathic effects and viral replication

  • Validation:

    • Confirm production of infectious virus by passage in cell culture

    • Verify genetic stability by sequencing recovered virus

    • Compare growth kinetics and cytopathology with the parental virus

  • Applications:

    • Introduce specific mutations to study gene function

    • Create reporter viruses by inserting fluorescent protein genes

    • Develop attenuated virus strains for potential vaccine development

The successful generation of infectious ANV-1 from in vitro transcripts has been demonstrated, with transfected chicken kidney cells producing virus with cytopathic effects in the absence of trypsin .

What cell culture systems are optimal for studying ANV-1 replication?

For studying ANV-1 replication in vitro:

  • Primary Cell Cultures:

    • Chicken kidney cells provide the most physiologically relevant system, as they support efficient virus replication and show cytopathic effects .

    • Primary chicken embryo fibroblasts or liver cells may also support viral growth.

  • Cell Line Considerations:

    • Evaluate avian cell lines such as LMH (chicken hepatocellular carcinoma) or DF-1 (chicken fibroblast) for susceptibility to infection.

    • Optimize culture conditions including serum concentration, temperature, and cellular differentiation status.

  • Monitoring Viral Replication:

    • Use quantitative RT-PCR to measure viral RNA levels

    • Develop immunofluorescence assays using antibodies against viral proteins

    • Employ virus titration methods to quantify infectious particles

  • Experimental Infections:

    • Inoculate cells at various multiplicities of infection (MOI)

    • Collect time points to establish growth curves

    • Analyze cellular responses to infection through transcriptomics or proteomics

What molecular diagnostic techniques are most effective for detecting ANV-1 genetic diversity?

Given the genetic diversity observed in ANV isolates, robust molecular diagnostic techniques are essential:

  • RT-PCR Based Methods:

    • Design primers targeting conserved regions of ORF1b (RdRp)

    • Develop nested or semi-nested PCR protocols for increased sensitivity

    • Implement real-time RT-PCR with broad-spectrum primers and probes

  • Next-Generation Sequencing (NGS):

    • Employ metagenomic approaches to detect novel ANV variants

    • Use targeted enrichment strategies to increase coverage of viral sequences

    • Apply deep sequencing to identify minor variants in mixed infections

  • Molecular Characterization:

    • Perform phylogenetic analysis based on partial or complete genome sequences

    • Use RFLP (Restriction Fragment Length Polymorphism) analysis for rapid genotyping

    • Implement HRM (High Resolution Melting) analysis for strain differentiation

  • Sample Collection Considerations:

    • Collect kidney tissue, intestinal contents, and fecal samples during the first 10 days post-infection when virus shedding is highest

    • Process samples promptly to preserve RNA integrity

The Merck Veterinary Manual specifically identifies PCR as the primary diagnostic tool for ANV infections , reflecting its sensitivity and specificity for viral detection.

How does ANV-1 ORF1 contribute to viral pathogenesis in young chickens?

The contribution of ANV-1 ORF1 to pathogenesis involves several mechanisms:

  • Viral Replication:

    • The RdRp encoded by ORF1b is essential for viral genome replication

    • The serine protease encoded by ORF1a processes viral polyproteins required for replication complex formation

    • Efficient viral replication leads to direct cytopathic effects in kidney cells

  • Immune Modulation:

    • Non-structural proteins may interfere with host innate immune responses

    • Potential suppression of interferon signaling pathways

    • Modulation of host cell translation machinery

  • Tissue Tropism:

    • ORF1 proteins may play a role in determining the kidney tropism of ANV-1

    • Replication efficiency in kidney cells contributes to the interstitial nephritis observed in infected chickens

  • Age-dependent Susceptibility:

    • Young chickens (<7 days old) are most susceptible to clinical disease

    • ORF1 proteins may interact differently with host factors in young versus mature birds

What are the challenges in developing effective control strategies against ANV-1?

Developing effective control strategies for ANV-1 faces several challenges:

  • Genetic Diversity:

    • High sequence diversity among ANV isolates

    • Co-circulation of multiple genetic variants

    • Recombination events generating novel variants

  • Persistent Environmental Contamination:

    • Viral shedding in feces for up to 10 days post-infection

    • Environmental resistance of astroviruses

    • Challenges in facility decontamination

  • Transmission Dynamics:

    • Both horizontal (direct or indirect contact) and vertical transmission

    • Subclinical infections in some birds and species (e.g., turkeys)

    • Multiple host species including chickens, ducks, and geese

  • Prevention Approaches:

    • No vaccines currently available

    • Reliance on improved husbandry and biosecurity measures

    • Limited antiviral options targeting astrovirus proteins

  • Diagnostic Limitations:

    • Need for sensitive and broad-spectrum molecular detection methods

    • Challenges in differentiating pathogenic from non-pathogenic strains

    • Co-infections with other avian pathogens complicating diagnosis

What novel approaches could be employed to study ANV-1 ORF1 protein interactions with host factors?

Advanced techniques for studying ANV-1 ORF1 protein-host interactions include:

  • Proximity Labeling Proteomics:

    • Use BioID or APEX2 fusion proteins to identify proximal host proteins

    • Generate comprehensive interactomes of individual viral proteins

    • Validate key interactions through complementary approaches

  • CRISPR Screening:

    • Conduct genome-wide CRISPR knockout or activation screens to identify host factors required for viral replication

    • Perform targeted screens focused on specific cellular pathways

    • Validate findings using individual gene knockouts or knockdowns

  • Structural Biology Approaches:

    • Resolve structures of ORF1 proteins alone and in complex with host factors

    • Use cryo-electron microscopy for larger protein complexes

    • Apply computational modeling to predict interaction interfaces

  • Systems Biology:

    • Integrate transcriptomics, proteomics, and metabolomics data from infected cells

    • Map temporal changes in host pathways during infection

    • Construct network models of virus-host interactions

  • Organoid and Ex Vivo Systems:

    • Develop avian kidney organoids for studying infection in more physiological systems

    • Use ex vivo kidney slice cultures to bridge in vitro and in vivo studies

    • Compare host responses across different tissue and cell types

How might comparative genomics across different ANV strains inform antiviral development?

Comparative genomics approaches offer valuable insights for antiviral development:

  • Identification of Conserved Targets:

    • Analyze sequence conservation across diverse ANV strains

    • Identify highly conserved regions in ORF1 as potential antiviral targets

    • Focus on functionally critical motifs such as the serine protease catalytic site or RdRp active site

  • Structural Comparisons:

    • Generate structural models of ORF1 proteins from different ANV strains

    • Identify conserved binding pockets suitable for small molecule inhibitors

    • Design broad-spectrum inhibitors targeting conserved structural features

  • Resistance Prediction:

    • Analyze natural polymorphisms in drug target regions

    • Predict potential resistance mutations based on structural and evolutionary data

    • Develop combination approaches targeting multiple viral functions

  • Cross-Species Applications:

    • Compare ANV-1 ORF1 with other avian and mammalian astroviruses

    • Identify antivirals with potential broad-spectrum activity

    • Leverage insights from human astrovirus research for ANV control

  • Informed Vaccine Design:

    • Identify conserved B and T cell epitopes across strains

    • Design polyvalent vaccines incorporating multiple strain variants

    • Explore recombinant protein or viral vector approaches expressing conserved ORF1 epitopes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.