Recombinant Azoarcus sp. Disulfide bond formation protein B (dsbB)

Shipped with Ice Packs
In Stock

Description

Introduction to DsbB in Azoarcus sp.

DsbB is an integral membrane protein that regenerates the oxidized state of DsbA, a periplasmic oxidoreductase responsible for introducing disulfide bonds into substrate proteins . In Azoarcus sp., recombinant DsbB (UniProt: A1KAY2) is produced in Escherichia coli with an N-terminal His tag for purification . Its gene (azo3372) encodes a 166-residue protein with four transmembrane helices and two periplasmic loops containing catalytic cysteines .

Domain Architecture

  • Transmembrane regions: Four α-helices anchor DsbB in the cytoplasmic membrane .

  • Periplasmic loops:

    • First loop: Contains the Cys41–Cys44 motif proximal to bound quinones .

    • Second loop: Houses the Cys104–Cys130 motif critical for disulfide exchange with DsbA .

Mechanism of Action

DsbB transfers electrons from reduced DsbA to membrane-embedded quinones via a redox relay (Fig. 1) :

  1. DsbA oxidizes substrate proteins, becoming reduced.

  2. Reduced DsbA transfers electrons to DsbB’s Cys104–Cys130 pair.

  3. Electrons flow through DsbB’s Cys41–Cys44 to ubiquinone/menaquinone, regenerating oxidized DsbA .

Expression System

  • Host: E. coli .

  • Tag: N-terminal His tag for affinity chromatography .

  • Storage: Tris-based buffer with 50% glycerol at -20°C or -80°C .

Amino Acid Sequence

The full-length protein (1–166 aa) includes:

  • Signal peptide: MIALPRNRRPLFLAVFAYCAALLAFGLYLQHYQGIEPCPMCIMQRYAFALVGVIALVAGL .

  • Catalytic motifs: Cys41–Cys44 and Cys104–Cys130 .

Key Studies

ApplicationFindingsReference
Oxidative folding pathwaysDsbB’s quinone-binding site is essential for reoxidizing DsbA in E. coli
Antibiotic target validationDsbB inhibitors (e.g., pyridazinones) show reduced resistance development
Structural modelingHybrid X-ray/NMR models resolve DsbB’s membrane topology and flexibility

Biochemical Assays

  • Ubiquinone affinity: Wild-type DsbB exhibits a Km of 0.9 μM for ubiquinone .

  • Anaerobic activity: Mutations (e.g., R48H) impair quinone reduction under low oxygen .

Future Directions

While Azoarcus sp. DsbB shares functional homology with E. coli DsbB , species-specific adaptations remain unexplored. Potential research avenues include:

  • Structural comparisons: Cryo-EM studies to resolve quinone-binding dynamics.

  • Pathogen targeting: Exploiting DsbB’s role in virulence for antibiotic design .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them during order placement. We will fulfill your request as best as possible.
Lead Time
Delivery time may vary based on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. For dry ice shipment, please communicate your request in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
dsbB; azo3372; Disulfide bond formation protein B; Disulfide oxidoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Azoarcus sp. (strain BH72)
Target Names
dsbB
Target Protein Sequence
MIALPRNRRPLFLAVFAYCAALLAFGLYLQHYQGIEPCPMCIMQRYAFALVGVIALVAGL HGPRGAGVRVYGGLLLLTALAGGSVAARQTWMQLYPPEIPECGPGLEYMLESFPLTSALP MIFRGAGDCSAIDWTFLGLSLANWSLLNFGAAALLALWLLFGRRVR
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain periplasmic proteins. It functions by oxidizing the DsbA protein.
Database Links

KEGG: azo:azo3372

STRING: 62928.azo3372

Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of DsbB protein in Azoarcus sp.?

DsbB in Azoarcus sp., similar to its role in other bacteria such as Escherichia coli, functions as an inner membrane protein that participates in the disulfide bond formation pathway. Based on established bacterial models, DsbB transfers electrons from DsbA (a periplasmic protein) to quinones, thereby regenerating the active state of DsbA, which is the primary catalyst for disulfide bond formation in substrate proteins . This electron transfer mechanism is essential for maintaining a continuous cycle of disulfide bond formation in the bacterial periplasm. The DsbA-DsbB system contributes significantly to the structural integrity and functionality of proteins involved in various cellular processes, including outer membrane biogenesis, cell division, and potentially antibiotic resistance mechanisms .

How does DsbB function in the disulfide bond formation pathway?

DsbB acts as an oxidoreductase that maintains DsbA in its oxidized, active form. The mechanistic cycle begins when DsbA catalyzes disulfide bond formation in substrate proteins, becoming reduced in the process. DsbB then reoxidizes DsbA through a series of thiol-disulfide exchange reactions involving conserved cysteine residues. Electrons from this reaction are subsequently transferred to ubiquinone under aerobic conditions or menaquinone under anaerobic conditions, ultimately feeding into the respiratory chain . This continuous regeneration cycle ensures that DsbA remains available to catalyze disulfide bond formation in newly synthesized proteins entering the periplasm. In contrast to this DsbB-dependent mechanism, some bacteria like mycobacteria utilize an alternative enzyme named VKOR, which performs functionally equivalent roles in disulfide bond formation .

What methods are used to express and purify recombinant Azoarcus sp. DsbB?

Expressing and purifying recombinant Azoarcus sp. DsbB requires specialized approaches due to its nature as a membrane protein. The recommended expression methodology includes:

  • Molecular cloning of the Azoarcus sp. dsbB gene into an expression vector containing:

    • An inducible promoter (T7 or arabinose-inducible systems)

    • An affinity tag (His6, often at the C-terminus to avoid interference with membrane insertion)

    • Appropriate antibiotic resistance markers

  • Transformation into specialized E. coli strains designed for membrane protein expression, such as C41(DE3) or C43(DE3), which better tolerate potential toxicity.

  • Optimized expression conditions:

    • Lower induction temperatures (16-20°C)

    • Extended expression periods (overnight)

    • Use of rich media supplemented with glucose

  • Membrane protein purification workflow:

    • Cell disruption (sonication or high-pressure homogenization)

    • Membrane fraction isolation via ultracentrifugation

    • Solubilization using mild detergents (n-dodecyl-β-D-maltoside or n-octyl-β-D-glucopyranoside)

    • Affinity chromatography purification

    • Size exclusion chromatography for higher purity

Optimization strategies might include codon optimization of the dsbB gene sequence for E. coli expression and co-expression with chaperone proteins to improve folding efficiency.

How can I verify the activity of recombinant Azoarcus sp. DsbB?

Verifying the activity of recombinant Azoarcus sp. DsbB can be accomplished through several complementary approaches:

  • β-Gal dbs biosensor system: This approach utilizes a periplasmic β-Galactosidase sensor that is only active when disulfide bond formation is inhibited . By expressing this sensor in cells with and without functional DsbB, and measuring β-Galactosidase activity using substrates like X-Gal or ONPG, you can assess DsbB functionality. Active DsbB will result in low β-Gal activity, while inactive DsbB will show high activity .

  • In vitro ubiquinone reduction assay: This spectrophotometric assay monitors the DsbB-catalyzed reduction of ubiquinone coupled to DsbA oxidation. The reaction can be followed by measuring the decrease in absorbance at 275 nm over time.

  • DsbA oxidation state analysis: Using thiol-reactive agents like AMS (4-acetamido-4'-maleimidylstilbene-2,2'-disulfonic acid) that cause mobility shifts of reduced versus oxidized proteins on SDS-PAGE, you can monitor the ability of DsbB to oxidize reduced DsbA.

  • Complementation studies: Introducing Azoarcus sp. DsbB into E. coli dsbB mutants and assessing restoration of phenotypes dependent on proper disulfide bond formation provides functional verification in a cellular context.

What is known about the structure of DsbB proteins in bacteria?

The structure of DsbB has been characterized primarily in E. coli, revealing a membrane protein with four transmembrane helices and two periplasmic loops containing conserved cysteine residues essential for function . These cysteines form and transfer disulfide bonds during the catalytic cycle. While specific structural information for Azoarcus sp. DsbB is not yet available in the literature, comparative sequence analysis would likely reveal conservation of these key structural elements.

Key structural features of bacterial DsbB proteins include:

  • Four transmembrane α-helical segments spanning the inner membrane

  • Two periplasmic loops containing conserved cysteine pairs (typically Cys41-Cys44 and Cys104-Cys130 in E. coli numbering)

  • A quinone binding site formed by specific residues in the second periplasmic loop and transmembrane regions

  • Interaction surfaces for binding to DsbA, primarily involving the periplasmic loops

These structural elements work together to facilitate the electron transfer from reduced DsbA to quinones, maintaining the disulfide bond formation cycle in the bacterial periplasm.

What are the experimental challenges in studying recombinant Azoarcus sp. DsbB?

Investigating recombinant Azoarcus sp. DsbB presents several technical challenges that require careful experimental design and optimization:

  • Membrane protein expression barriers: As an integral membrane protein, DsbB often faces expression challenges including toxicity to host cells, inclusion body formation, and improper membrane insertion. Optimization of expression conditions and selection of appropriate host strains are critical.

  • Protein purification complexities: Extracting and purifying DsbB while maintaining its native structure and function requires careful selection of detergents and buffer conditions. The choice of detergent affects protein stability, activity, and suitability for downstream applications like crystallization.

  • Functional assay development: Developing specific and sensitive assays for Azoarcus sp. DsbB activity requires consideration of its natural substrates and electron acceptors. Adaptation of existing assays or development of new ones may be necessary.

  • Genetic manipulation limitations: Genetic tools for Azoarcus sp. may be less developed compared to model organisms. As observed with Azospira suillum PS, "conjugation proved to be an unpredictable method of vector delivery" and even with electroporation, "efficiency of integration was low" . Similar challenges might apply to Azoarcus sp.

  • Contextual function analysis: Understanding DsbB function in the physiological context of Azoarcus sp., especially in relation to specialized processes like nitrogen fixation and formation of intracytoplasmic membranes (diazosomes) , requires integrative approaches beyond in vitro biochemical characterization.

These challenges necessitate multifaceted approaches combining molecular biology, biochemistry, and structural biology techniques.

How does environmental oxygen concentration affect DsbB expression and function in Azoarcus sp.?

The relationship between oxygen concentration and DsbB function in Azoarcus sp. is particularly intriguing given that this bacterium fixes nitrogen under microaerobic conditions . While direct experimental evidence on this relationship is limited, several mechanistic hypotheses can be proposed:

  • Adaptation to microaerobic conditions: During microaerobic growth, Azoarcus sp. strain BH72 forms specialized intracytoplasmic membrane structures called diazosomes that are associated with nitrogen fixation . These membrane remodeling events likely involve changes in the disulfide bond formation system to support proper folding of proteins associated with these specialized structures.

  • Redox partner switching: Under varying oxygen conditions, DsbB might switch between different quinone types as electron acceptors (ubiquinone under aerobic conditions versus menaquinone under anaerobic/microaerobic conditions). This flexibility would allow the disulfide bond formation pathway to remain functional across different oxygen tensions.

  • Regulatory mechanisms: Oxygen-responsive transcriptional regulators might modulate dsbB expression levels in response to changing oxygen concentrations. This could involve integration with nitrogen fixation regulatory networks to coordinate protein folding capacity with metabolic shifts.

  • Functional adaptation: The specific activity or substrate preference of DsbB might change under different oxygen concentrations, potentially through post-translational modifications or interactions with regulatory proteins.

The study of Azoarcus sp. strain BH72 revealed that under nitrogen-fixing conditions, significant changes in protein composition occur, including the appearance of new membrane proteins . Investigating whether DsbB is among these differentially expressed proteins would provide insights into its role during microaerobic growth.

What is the relationship between DsbB and nitrogen fixation in Azoarcus sp.?

The potential relationship between DsbB and nitrogen fixation in Azoarcus sp. represents an intriguing area for investigation. Azoarcus sp. strain BH72 is known to fix nitrogen under microaerobic conditions and forms specialized intracytoplasmic membrane structures (diazosomes) during this process . Several potential connections between DsbB function and nitrogen fixation can be hypothesized:

  • Support for membrane remodeling: The formation of diazosomes involves significant membrane remodeling and protein composition changes . DsbB might play a critical role in ensuring proper folding and stability of membrane and periplasmic proteins involved in this process.

  • Oxygen protection mechanisms: Nitrogenase, the enzyme complex responsible for nitrogen fixation, is highly oxygen-sensitive. While nitrogenase itself typically doesn't contain disulfide bonds, many accessory proteins involved in oxygen protection may require proper disulfide bond formation for their function.

  • Electron transport components: The electron transport chains that supply energy for nitrogen fixation often involve periplasmic electron carriers, some of which might require disulfide bonds for structural integrity or functional interactions.

  • Regulatory connections: The regulation of nitrogen fixation and disulfide bond formation pathways might be coordinated to ensure protein folding capacity matches the cell's needs during metabolic shifts to nitrogen fixation.

Notably, during diazosome formation in Azoarcus sp., significant changes in protein composition occur, including the appearance of new membrane proteins (MP1 to MP6) . Whether DsbB is regulated as part of this response and how it contributes to the specialized physiology of nitrogen-fixing cells are questions warranting further investigation.

How can mutagenesis approaches be used to study the function of DsbB in Azoarcus sp.?

Mutagenesis approaches provide powerful tools for investigating DsbB function in Azoarcus sp. Based on strategies used for other bacterial systems, several complementary approaches can be employed:

Phenotypic analyses following mutagenesis should include:

  • Growth characteristics under various stress conditions

  • Activity of periplasmic enzymes known to require disulfide bonds

  • Formation and function of specialized membrane structures like diazosomes

  • Nitrogen fixation efficiency

  • Sensitivity to reducing agents and oxidative stress

The integration of these mutagenesis approaches with biochemical and structural studies would provide comprehensive insights into DsbB function in Azoarcus sp.

What bioinformatic approaches can be used to identify potential DsbB substrates in Azoarcus sp.?

Identifying the substrate proteins that depend on the DsbB/DsbA system for proper folding requires sophisticated bioinformatic analyses. A comprehensive strategy would include:

  • Genomic identification of potential substrate proteins:

    • Predict proteins containing signal peptides targeting them to the periplasm using SignalP or similar tools

    • Identify proteins with even numbers of cysteine residues (potential disulfide bond-forming pairs)

    • Filter for proteins lacking transmembrane helices (except for outer membrane proteins)

    • Calculate cysteine spacing patterns to identify potential disulfide bond configurations

  • Comparative genomic analysis:

    • Identify Azoarcus sp. orthologs of known DsbA substrates from model organisms

    • Perform phylogenetic profiling to find proteins that co-evolved with DsbA/DsbB systems

    • Compare cysteine conservation patterns across related species

  • Structural prediction approaches:

    • Use homology modeling and threading approaches to predict protein structures

    • Identify spatially proximate cysteine residues likely to form disulfide bonds

    • Apply specialized algorithms that predict disulfide connectivity based on sequence alone

  • Integration with experimental data:

    • Correlate predictions with proteomic data comparing wild-type and dsbB mutant strains

    • Prioritize candidates based on phenotypic effects observed in dsbB mutants

    • Focus on proteins relevant to specific functions affected by dsbB mutation (e.g., nitrogen fixation)

A particularly valuable approach would be to create a scoring system that integrates multiple predictive features to generate a ranked list of likely DsbA/DsbB substrate proteins for experimental validation. This systematic approach would accelerate the discovery of functionally relevant substrate proteins and provide insights into the physiological roles of the DsbB system in Azoarcus sp.

How can the β-Gal dbs biosensor system be adapted to study Azoarcus sp. DsbB?

The β-Gal dbs biosensor system represents a powerful tool for studying disulfide bond formation that can be adapted for investigating Azoarcus sp. DsbB. Based on the system described for Pseudomonas aeruginosa , the adaptation would involve:

  • Vector construction and optimization:

    • Clone the β-Gal dbs gene into one of the mobilizable plasmids with tightly regulated inducible promoters (Cuma-, aTc-, or Van-inducible)

    • Optimize expression levels by adjusting inducer concentration to achieve the desired sensitivity

    • The choice of promoter is critical, as the Cuma- and aTc-inducible systems showed better dynamic range and lower background activity in P. aeruginosa compared to other systems

  • Implementation strategies:

    • Heterologous approach: Express Azoarcus sp. DsbB in E. coli dsbB mutants together with the β-Gal dbs sensor

    • Native approach: If genetic tools permit, introduce the β-Gal dbs sensor directly into Azoarcus sp. wild-type and dsbB mutant strains

  • Assay formats:

    • Plate-based screening: Grow cells on media containing X-Gal to visualize β-Galactosidase activity through blue color development

    • Quantitative liquid assays: Measure β-Galactosidase activity in cell lysates using ONPG as substrate and calculating Miller Units

    • High-throughput adaptation: Develop 96-well or 384-well plate formats for screening inhibitors or mutant libraries

  • Experimental applications:

    • Assess the function of wild-type versus mutant versions of Azoarcus sp. DsbB

    • Screen for environmental conditions that affect DsbB function

    • Identify chemical inhibitors of DsbB activity

    • Study the effects of oxidative or reductive stress on the disulfide bond formation system

What are the implications of targeting DsbB for antimicrobial development against Azoarcus-related pathogens?

While Azoarcus sp. itself is not typically considered pathogenic, insights from studying its DsbB protein have broader implications for antimicrobial development against related bacterial pathogens. The DsbA-DsbB system represents an attractive target for novel antimicrobials for several compelling reasons :

  • Multi-target effect: Inhibition of DsbB affects the folding of numerous proteins simultaneously, potentially disrupting multiple cellular processes including:

    • Virulence factor assembly and secretion

    • Outer membrane biogenesis

    • Cell division

    • Antibiotic resistance mechanisms

  • Conservation and specificity: The DsbB protein is well-conserved among gram-negative bacteria but absent in mammalian cells, making it a potentially selective target. Structural differences between DsbB proteins from different bacterial species could be exploited for species-specific targeting.

  • Resistance considerations: The development of resistance to DsbB inhibitors might be less likely compared to traditional antibiotics because:

    • Multiple proteins and processes are affected simultaneously

    • The essential nature of disulfide bond formation for bacterial envelope integrity

    • Limited options for functional redundancy (though some bacteria like P. aeruginosa have multiple DsbB homologs )

  • Screening infrastructure: The β-Gal dbs biosensor system offers a ready platform for high-throughput screening of potential DsbB inhibitors . This system has already been successfully applied to identify inhibitors against P. aeruginosa DsbB proteins and could be adapted for screening against other gram-negative pathogens.

  • Combination potential: DsbB inhibitors could potentially sensitize bacteria to existing antibiotics by compromising envelope integrity or resistance mechanisms, offering possibilities for combination therapy approaches.

The development of mobilizable plasmids carrying the β-Gal dbs biosensor provides valuable tools for extending inhibitor screening to diverse gram-negative pathogens related to Azoarcus sp.

How does oxygen availability affect the expression and function of DsbB in Azoarcus sp.?

Oxygen availability likely plays a significant regulatory role in DsbB expression and function in Azoarcus sp., especially considering this organism's ability to fix nitrogen under microaerobic conditions . Several potential oxygen-dependent regulatory mechanisms can be proposed:

  • Transcriptional regulation: Oxygen-sensitive transcription factors might modulate dsbB expression levels in response to changing oxygen concentrations. This could involve integration with the nitrogen fixation regulatory cascade, which is known to respond to oxygen availability.

  • Quinone pool adaptation: Under different oxygen concentrations, the composition of the quinone pool shifts (ubiquinone predominates under aerobic conditions, while menaquinone increases under anaerobic conditions). DsbB activity depends on electron transfer to quinones, so these shifts likely affect its function and efficiency.

  • Specialized membrane adaptations: During microaerobic growth, Azoarcus sp. forms specialized intracytoplasmic membrane structures (diazosomes) . This membrane remodeling may affect DsbB localization, concentration, or access to substrate proteins.

  • Protein expression profile changes: The shift to microaerobic conditions in Azoarcus sp. triggers significant changes in protein composition, with some proteins disappearing and new proteins appearing . These changes likely reflect a metabolic adaptation that could include adjustments to the disulfide bond formation system.

  • Redox balance considerations: Oxygen limitation alters the cellular redox state, potentially affecting the redox potential of the periplasm. Since disulfide bond formation is fundamentally a redox process, these changes would necessitate adaptations in the DsbB-DsbA system.

The striking differences in protein patterns observed upon diazosome formation suggest that Azoarcus sp. undergoes extensive proteome remodeling during the transition to microaerobic, nitrogen-fixing conditions. Investigating whether and how DsbB participates in this adaptation would provide valuable insights into its oxygen-dependent regulation.

What structural features distinguish Azoarcus sp. DsbB from other bacterial homologs?

While structural information specific to Azoarcus sp. DsbB is currently limited in the literature, several potentially distinguishing features can be predicted based on comparative analysis with other bacterial homologs:

  • Transmembrane topology: All DsbB proteins are expected to share the core architecture of four transmembrane helices, but the specific length, hydrophobicity, and packing of these helices may show species-specific adaptations related to membrane composition and thickness.

  • Cysteine arrangement: The catalytic cysteines in the periplasmic loops are likely conserved, but their precise spacing and local environment might be optimized for the redox conditions encountered by Azoarcus sp., particularly during microaerobic growth and nitrogen fixation.

  • Quinone binding site: The quinone binding pocket might show adaptations related to the specific types and ratios of quinones utilized by Azoarcus sp. under different growth conditions. This could involve substitutions in the amino acids lining the binding site.

  • DsbA interaction interface: The surface that interacts with DsbA likely shows co-evolutionary adaptations to maintain specific and efficient interaction with the Azoarcus sp. DsbA protein(s).

  • Regulatory elements: Potential sites for post-translational modification or regulatory protein interactions might exist in Azoarcus sp. DsbB that are not present in other bacterial homologs, reflecting its integration into specific regulatory networks.

  • Membrane anchoring: Specific features that determine localization within the complex membrane system of Azoarcus sp., particularly in relation to the diazosomes formed during nitrogen fixation , might distinguish it from other DsbB proteins.

Structural studies including X-ray crystallography, cryo-electron microscopy, or computational modeling would be necessary to fully characterize these potential distinguishing features. Such structural insights would inform understanding of how DsbB function is adapted to the specific ecological niche and physiological capabilities of Azoarcus sp.

What purification strategies are most effective for recombinant Azoarcus sp. DsbB?

Purifying membrane proteins like Azoarcus sp. DsbB requires specialized approaches to maintain structural integrity and functional activity. The following multi-step purification strategy is recommended:

  • Membrane preparation:

    • Harvest cells expressing recombinant DsbB and resuspend in buffer containing protease inhibitors

    • Disrupt cells via sonication or high-pressure homogenization

    • Remove cell debris by low-speed centrifugation (10,000 × g)

    • Isolate membrane fraction by ultracentrifugation (150,000 × g for 1 hour)

    • Wash membranes to remove peripheral proteins

  • Detergent solubilization optimization:

    • Screen multiple detergents for efficient extraction while maintaining function

    • Recommended detergents include:

      • n-Dodecyl-β-D-maltoside (DDM): Mild, often preserves function

      • n-Octyl-β-D-glucopyranoside (OG): Good for crystallization

      • Lauryl maltose neopentyl glycol (LMNG): Enhanced stability

    • Typical solubilization conditions: 1-2% detergent, 4°C, gentle rotation for 1-2 hours

  • Affinity chromatography:

    • For His-tagged DsbB: Immobilized metal affinity chromatography (IMAC)

    • Load solubilized material onto Ni-NTA or TALON resin

    • Wash with increasing imidazole concentrations (10-40 mM)

    • Elute with higher imidazole (250-500 mM)

    • Maintain detergent above critical micelle concentration in all buffers

  • Secondary purification:

    • Size exclusion chromatography to remove aggregates and improve purity

    • Recommended columns: Superdex 200 or Superose 6

    • Ion exchange chromatography as an alternative or additional step

  • Stability enhancement strategies:

    • Addition of lipids (E. coli polar lipid extract at 0.1-0.5 mg/ml)

    • Glycerol (10-15%) to prevent aggregation

    • Reducing agents (if necessary to prevent non-native disulfide formation)

  • Alternative purification platforms:

    • Reconstitution into nanodiscs or liposomes for enhanced stability

    • Amphipol exchange for detergent-free handling

Each step should be optimized empirically for Azoarcus sp. DsbB, with protein quality assessed by SDS-PAGE, western blotting, and activity assays to ensure that the purified protein maintains its native structure and function.

How can I determine the kinetic parameters of Azoarcus sp. DsbB?

Determining the kinetic parameters of Azoarcus sp. DsbB requires carefully designed experiments that account for its dual-substrate mechanism involving both DsbA and quinones. A comprehensive kinetic characterization approach includes:

  • Ubiquinone reduction assay setup:

    • Prepare reaction mixtures containing purified DsbB in detergent micelles, reduced DsbA, and varying concentrations of ubiquinone

    • Monitor decrease in absorbance at 275 nm (ubiquinone reduction) over time

    • Control temperature precisely (typically 25°C or 30°C)

    • Include appropriate controls (no DsbB, heat-inactivated DsbB)

  • Determination of quinone kinetics:

    • Maintain DsbA at saturating concentration

    • Vary ubiquinone concentration (typically 1-100 μM)

    • Calculate initial reaction velocities

    • Plot data using Michaelis-Menten equation to determine:

      • K<sub>m</sub> for ubiquinone

      • k<sub>cat</sub> for ubiquinone reduction

      • k<sub>cat</sub>/K<sub>m</sub> as catalytic efficiency

  • Determination of DsbA kinetics:

    • Maintain ubiquinone at saturating concentration

    • Vary reduced DsbA concentration (typically 1-50 μM)

    • Calculate initial reaction velocities

    • Plot data to determine:

      • K<sub>m</sub> for DsbA

      • k<sub>cat</sub> for DsbA oxidation

      • k<sub>cat</sub>/K<sub>m</sub> as catalytic efficiency

  • Alternative quinone substrate analysis:

    • Compare activity with different quinones (ubiquinone, menaquinone)

    • Determine kinetic parameters for each

    • Evaluate substrate preference under different redox conditions

  • pH and temperature dependence:

    • Determine optimal pH by measuring activity across pH range (typically 5.5-8.5)

    • Assess temperature dependence and calculate activation energy

  • Inhibition studies:

    • Test known DsbB inhibitors to determine:

      • IC<sub>50</sub> values

      • Inhibition mechanisms (competitive, non-competitive, uncompetitive)

      • Structure-activity relationships

The resulting kinetic parameters would provide valuable insights into the catalytic efficiency of Azoarcus sp. DsbB, its substrate preferences, and how these properties might reflect adaptations to the organism's ecological niche and metabolic capabilities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.