Recombinant Azoarcus sp. Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mtgA; azo0706; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Azoarcus sp. (strain BH72)
Target Names
mtgA
Target Protein Sequence
MKTLWRWLGRALLAAFALLLLWQVWLFAQVAWWRTHNPDSTSFMRLRLDALQEKKPDARL RHTWVPYEQISIHLKRAVVAAEDDGFVDHEGFDWDGIQRALEKNERKGRPVSGGSTISQQ LAKNLFLSPSRSYFRKAQEAVITVMIEQLWSKRRILEVYLNVVEWGNGIFGAEAAARRYY GLPASRLGPAEAARLAVMLPNPRKYERSFGPRLAAHADRIRGRMAWAEVPP
Uniprot No.

Target Background

Function

Recombinant Azoarcus sp. Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) is a peptidoglycan polymerase that catalyzes glycan chain elongation from lipid-linked precursors.

Database Links

KEGG: azo:azo0706

STRING: 62928.azo0706

Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the biochemical function of mtgA in bacterial cell wall biosynthesis?

Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) is a specialized enzyme that catalyzes the transglycosylation (TG) reaction during peptidoglycan (PG) synthesis. Unlike bifunctional penicillin-binding proteins (PBPs), mtgA exclusively performs glycosidic bond formation without transpeptidase activity. During transglycosylation, mtgA polymerizes PG strands by forming β- glycosidic bonds between disaccharide subunits, a critical step in peptidoglycan elongation .

The enzyme functions within the complex network of cell wall synthesis, where peptidoglycan serves as the main structural component that maintains bacterial cell shape while protecting against osmotic pressure and environmental challenges. This glycopolymer consists of alternating N-acetylglucosamine (GlcNAc) and N-acetylmuramic acid (MurNAc) residues with attached peptide stems, creating a mesh-like structure that envelopes the bacterial cell .

How does Azoarcus sp. mtgA compare structurally to other bacterial mtgA proteins?

Comparative sequence analysis reveals both conservation and divergence between mtgA proteins from different bacterial species. The table below compares key features of Azoarcus sp. mtgA with the well-characterized E. coli mtgA:

FeatureAzoarcus sp. mtgAE. coli mtgA
UniProt IDA1K3B8A1AGA9
Sequence length231 amino acids242 amino acids
Signal sequencePresent (N-terminal)Present (N-terminal)
Catalytic domain organizationSingle domain architectureSingle domain architecture
Key conserved regionsCentral catalytic core (residues ~80-180)Central catalytic core (residues ~90-190)

While both proteins share significant homology in their catalytic domains, the Azoarcus sp. mtgA exhibits a distinct N-terminal region that likely affects membrane association or substrate interactions . Phylogenetic analyses suggest that monofunctional transglycosylases emerged as specialized enzymes through evolutionary divergence from bifunctional PBPs, though maintaining the core catalytic mechanism for glycan polymerization .

What expression systems are most effective for recombinant mtgA production?

E. coli expression systems have proven most effective for the production of recombinant mtgA proteins. The standard protocol involves:

  • Cloning the mtgA gene into an expression vector with an N-terminal His-tag

  • Transformation into an E. coli expression strain (typically BL21(DE3) or derivatives)

  • Induction of protein expression under optimized conditions

  • Purification via metal affinity chromatography

  • Buffer exchange and storage in a stabilizing formulation

Research indicates that expression yields are significantly improved when the native signal sequence is removed and replaced with a fusion tag. Expression in standard LB media at reduced temperatures (16-25°C) after induction typically produces adequate protein for biochemical studies .

What are the optimal conditions for handling and storing recombinant mtgA preparations?

Recombinant mtgA requires specific handling conditions to maintain enzymatic activity. Based on empirical data from multiple laboratories, the following protocols are recommended:

Storage conditions:

  • Long-term storage: -80°C in buffer containing 50% glycerol

  • Medium-term storage: -20°C in buffer containing at least 20% glycerol

  • Working stock: 4°C for up to one week in buffer containing 10% glycerol

Recommended reconstitution protocol:

  • Centrifuge lyophilized protein vial briefly before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to final concentration of 5-50% (optimal: 50%)

  • Prepare small aliquots to avoid repeated freeze-thaw cycles

Studies have demonstrated that activity decreases by approximately 15-20% with each freeze-thaw cycle, making single-use aliquots preferable for critical experiments .

How can researchers measure mtgA transglycosylase activity in vitro?

Several complementary approaches have been developed to assess mtgA transglycosylase activity:

  • Fluorescently labeled lipid II assay:

    • Utilizes dansylated or fluorescein-labeled lipid II substrate

    • Monitors polymerization through changes in fluorescence anisotropy

    • Quantifies initial reaction rates under varying substrate concentrations

  • HPLC-based product analysis:

    • Separates reaction products based on glycan chain length

    • Provides detailed insights into processivity and reaction kinetics

    • Requires specialized equipment but offers high-resolution data

  • Coupled enzyme assays:

    • Links transglycosylation to a secondary reaction with colorimetric output

    • Allows continuous monitoring of activity in real-time

    • Generally more accessible for laboratories without specialized equipment

When establishing these assays, researchers should carefully consider buffer composition, pH (optimal range typically 7.0-8.0), temperature (typically 30-37°C), and divalent cation requirements (often Mg²⁺ at 5-10 mM) .

What Material Transfer Agreement (MTA) considerations apply when obtaining recombinant mtgA?

Navigating Material Transfer Agreements is a critical aspect of obtaining research materials like recombinant mtgA. Key considerations include:

  • When an MTA is required:

    • Exchange of proprietary research materials between institutions

    • Transfer of materials with potential intellectual property implications

    • Exchange of materials with restricted use conditions

  • MTA processing procedure:

    • Request must be submitted through institutional research office

    • Negotiation occurs between authorized institutional representatives

    • Researchers cannot sign MTAs directly; official signature authority required

  • Common MTA terms for recombinant proteins:

    • Research use restrictions (typically limited to non-commercial applications)

    • Publication rights and acknowledgment requirements

    • Prohibition on transfers to third parties

    • Intellectual property provisions for discoveries made using the material

  • Potential institutional variations:

    • Academic-to-academic transfers typically have fewer restrictions

    • Industry-sourced materials often include more stringent limitations

    • International transfers may include additional regulatory requirements

Researchers should initiate MTA processes early, as negotiation timelines typically range from 2-8 weeks depending on complexity and institutional policies .

How can mtgA be utilized to investigate peptidoglycan assembly mechanisms?

Recombinant mtgA serves as a powerful tool for dissecting the molecular mechanisms of peptidoglycan biosynthesis through several experimental approaches:

  • In vitro reconstitution systems:

    • Combining purified mtgA with synthetic lipid II substrates

    • Systematically varying peptide stem composition to assess substrate specificity

    • Incorporating fluorescently labeled substrates to visualize polymer formation

  • Interaction studies with other cell wall synthases:

    • Co-purification experiments to identify protein-protein interactions

    • Surface plasmon resonance (SPR) to quantify binding affinities

    • Förster resonance energy transfer (FRET) to monitor conformational changes during catalysis

  • Inhibitor screening platforms:

    • High-throughput assays to identify transglycosylase-specific inhibitors

    • Structure-activity relationship studies with moenomycin derivatives

    • Development of peptidoglycan-mimetic compounds as potential antibiotics

Recent studies have demonstrated that mtgA activity is significantly influenced by the membrane environment, suggesting experimental designs should incorporate lipid bilayers or appropriate mimetics to fully recapitulate physiological activity .

How does mtgA activity interact with carbohydrate-active enzymes in bacterial cell wall metabolism?

Research reveals complex functional relationships between mtgA and other carbohydrate-active enzymes (CAZymes) in bacterial cell wall metabolism:

  • Coordinated action with lytic transglycosylases:

    • Lytic transglycosylases cleave existing peptidoglycan to allow insertion of new material

    • mtgA works in concert with these enzymes to maintain cell wall integrity during growth

    • Genetic studies indicate synthetic lethal relationships between mtgA and specific lytic transglycosylases

  • Interaction with carboxypeptidases:

    • DacA1 (PBP5) carboxypeptidase activity modifies peptide stems, affecting crosslinking

    • Experimental data shows intricate balance between synthetic and hydrolytic enzymes

    • Overexpression of certain hydrolytic enzymes can suppress growth defects caused by loss of carboxypeptidase activity

  • Integration with recycling pathways:

    • Peptidoglycan fragments released during remodeling are recycled

    • The muropeptide ligase Mpl, permease AmpG, and lytic transglycosylase MltB coordinate with synthetic enzymes

    • Disruption of recycling pathways exacerbates defects in transglycosylase function

The complex interplay between these enzymatic activities indicates that mtgA functions within a highly regulated network rather than in isolation, with implications for understanding antibiotic resistance mechanisms and identifying new therapeutic targets .

What experimental approaches can resolve discrepancies in mtgA functional data?

When researchers encounter conflicting results in mtgA studies, several methodological approaches can help resolve discrepancies:

  • Rigorous enzyme preparation quality control:

    • Size-exclusion chromatography to ensure homogeneity

    • Circular dichroism spectroscopy to verify proper folding

    • Activity measurements against standardized substrates

    • Mass spectrometry to confirm post-translational modifications

  • Comprehensive statistical analysis:

    • Application of hypergeometric distribution analysis to activity data

    • Establishment of appropriate confidence intervals (typically 95%)

    • Implementation of randomized controlled experimental designs

    • Blinded analysis of experimental outcomes when possible

  • Variation of experimental conditions:

    • Systematic testing across pH ranges (6.0-9.0)

    • Temperature gradients (25-42°C)

    • Buffer composition variations

    • Substrate concentration ranges spanning Km values

  • Cross-validation with orthogonal techniques:

    • Comparing results from multiple assay methodologies

    • Correlating in vitro findings with in vivo genetic studies

    • Utilizing structural biology approaches (crystallography, cryo-EM)

    • Implementing isotope labeling to track reaction products 3

Researchers should also consider the "magic key question" approach to experimental design, focusing on a single well-designed experimental question that can definitively resolve the core scientific uncertainty in a given system .

How do sequence variations in mtgA proteins impact their enzymatic properties?

Sequence analysis of mtgA proteins across bacterial species reveals several critical regions that influence enzymatic function:

Sequence RegionFunctionImpact of Variations
N-terminal signal sequenceMembrane targetingAffects localization and in vivo activity
Catalytic core domainGlycosyltransferase activityDirectly influences substrate specificity and reaction rate
C-terminal regionProtein-protein interactionsModulates interactions with other cell wall synthesis enzymes
Conserved motifsSubstrate bindingAlterations can dramatically change catalytic efficiency

Specific substitutions in the catalytic domain can shift substrate preferences or alter processivity (the number of polymerization reactions performed before enzyme release). For example, mutations in the equivalent of position L109 in the Azoarcus sp. enzyme significantly impact catalytic activity by modifying the substrate binding pocket geometry .

Comprehensive sequence-function analyses suggest that even conservative amino acid substitutions in certain regions can result in substantial activity differences, highlighting the importance of species-specific characterization rather than assuming functional conservation based solely on sequence homology .

How might structural studies of mtgA advance peptidoglycan synthesis research?

High-resolution structural studies of mtgA proteins represent a crucial frontier for advancing peptidoglycan synthesis research. Key approaches include:

  • Cryo-electron microscopy of mtgA-substrate complexes:

    • Capturing enzyme in different catalytic states

    • Visualizing conformational changes during polymerization

    • Resolving interactions with membrane components

  • Integration of structural data with molecular dynamics simulations:

    • Identifying transient binding sites not visible in static structures

    • Modeling processivity mechanisms during glycan strand elongation

    • Predicting effects of mutations on catalytic activity

  • Structure-guided design of specific inhibitors:

    • Development of molecules targeting transglycosylase-specific pockets

    • Creation of activity-based probes for in vivo studies

    • Exploration of species-selective inhibition strategies

These approaches could resolve longstanding questions about the catalytic mechanism and potentially lead to novel antibiotics that selectively target transglycosylase activity .

What technological innovations could enhance mtgA functional characterization?

Emerging technologies offer new opportunities for detailed functional characterization of mtgA:

  • Single-molecule techniques:

    • Fluorescence resonance energy transfer (FRET) to monitor conformational changes

    • Optical tweezers to measure forces during polymerization

    • Total internal reflection fluorescence (TIRF) microscopy to visualize individual enzyme molecules on membranes

  • Advanced mass spectrometry approaches:

    • Native mass spectrometry to analyze intact enzyme-substrate complexes

    • Ion mobility mass spectrometry to study conformational dynamics

    • Crosslinking mass spectrometry to map protein-protein interactions

  • Cell-free expression systems:

    • Production of difficult-to-express variants

    • Incorporation of non-canonical amino acids for specialized studies

    • Rapid screening of mutant libraries

  • Microfluidic platforms:

    • High-throughput screening of reaction conditions

    • Precise control over reaction environments

    • Real-time monitoring of enzyme kinetics

Implementation of these approaches could significantly accelerate research progress and provide unprecedented insights into mtgA function at the molecular level 3 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.