Recombinant Azoarcus sp. Probable intracellular septation protein A (azo1706)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Information

PropertyDetail
Gene Nameazo1706
SynonymsyciB; Inner membrane-spanning protein YciB
UniProt IDA1K668
Protein LengthFull-length (1–202 amino acids)
TagN-terminal His tag
Source OrganismAzoarcus sp. (strain BH72)
HostE. coli

The amino acid sequence of azo1706 reveals hydrophobic regions and transmembrane domains, suggesting a role in membrane-associated processes. Key sequence segments include:
N-terminal: MKFFLDLLPVILFFVAYKFAGAAPDDSHALVAQFLGAGISPSQAPILIATAVAIAATLAQ
Mid-region: VLIVWLRHGKVDKMLWVSLAIITLFGGATLVFHNPTFIKWKPTVFYWTFAGALAVSALLF
C-terminal: RRNLVQKMLEAQIRLPAPVWQRLNLAWIGFFTLMGFLNLYVAYGYSEEAWVNFKLFGAMGLMLAFFLGQGFYLSRHLEEDAK

Production and Quality

ParameterDescription
Purity>90% (SDS-PAGE)
FormLyophilized powder
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0 ; 50% glycerol (optimized)
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL)
StabilityStore at -20°C/-80°C; avoid repeated freeze-thaw cycles

Potential Applications

  1. Structural Biology: Study of membrane protein folding and stability.

  2. Cell Biology: Investigation of bacterial division mechanisms.

  3. Biotechnology: Development of novel antibiotics targeting septation proteins.

Challenges and Knowledge Gaps

  • Functional Studies: No published data on enzymatic activity or interaction partners.

  • Regulation: Unknown regulatory pathways or environmental triggers for expression.

  • Evolutionary Context: Limited comparative analysis with orthologs in other Azoarcus species.

Comparative Analysis with Related Proteins

ProteinSourceFunctionKey Differences
azo1706Azoarcus sp. BH72Probable septation proteinHis-tagged; full-length
YciBE. coliMembrane remodeling during divisionShorter sequence; no tag
UPF0246 (azo1887)Azoarcus sp. BH72Unknown functionNot membrane-spanning

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. If you have specific requirements for the format, please indicate them in your order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary based on the purchase method and location. Please contact your local distributor for specific delivery time information.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing it for you.
Synonyms
yciB; azo1706; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Azoarcus sp. (strain BH72)
Target Names
azo1706
Target Protein Sequence
MKFFLDLLPVILFFVAYKFAGAAPDDSHALVAQFLGAGISPSQAPILIATAVAIAATLAQ VLIVWLRHGKVDKMLWVSLAIITLFGGATLVFHNPTFIKWKPTVFYWTFAGALAVSALLF RRNLVQKMLEAQIRLPAPVWQRLNLAWIGFFTLMGFLNLYVAYGYSEEAWVNFKLFGAMG LMLAFFLGQGFYLSRHLEEDAK
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links

KEGG: azo:azo1706

STRING: 62928.azo1706

Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Azoarcus sp. Probable intracellular septation protein A (azo1706)?

Azo1706 is a protein identified in Azoarcus species, a genus of diazotrophic (nitrogen-fixing) Proteobacteria that commonly establishes associations with grass roots, particularly rice. Based on genomic annotation, this protein is classified as a "probable intracellular septation protein A," suggesting its involvement in bacterial cell division processes . The full-length protein consists of 202 amino acids and is available as a recombinant His-tagged protein expressed in E. coli for research purposes .

Azoarcus species are of significant research interest because they represent mutualistic endophytes that supply biologically fixed nitrogen to host plants without eliciting disease symptoms, making them important subjects for agricultural biotechnology studies . The azo1706 protein may play a role in the bacterial cell division processes that enable successful colonization of plant tissues.

What is the genomic context of azo1706 within Azoarcus species?

The azo1706 gene is encoded within the Azoarcus genome, which in the well-studied strain BH72 consists of 4,376,040 base pairs and contains 3,992 predicted protein-coding sequences . While specific information about the genomic neighborhood of azo1706 is limited in current research literature, Azoarcus genomes are notable for containing remarkably few mobile elements, indicating a low rate of recent gene transfer . This genomic stability is thought to reflect adaptation to a stable, low-stress microenvironment within plant hosts.

When studying azo1706's genomic context, researchers should consider:

  • Operon structure and co-transcribed genes

  • Conserved gene neighborhoods across Azoarcus strains

  • Presence of regulatory elements in the promoter region

  • Evolutionary conservation compared to soil-dwelling versus plant-associated Azoarcus strains

Comparative genomic approaches between Azoarcus species can provide insights into the evolutionary importance of azo1706, particularly between endophytic strains like BH72 and soil-dwelling species like A. tolulyticus and A. evansii .

How can researchers experimentally determine the function of azo1706?

Determining the function of azo1706 requires a multi-faceted experimental approach:

  • Gene knockouts/disruptions: Creating azo1706 deletion mutants in Azoarcus sp. using marker exchange mutagenesis similar to approaches used for other Azoarcus genes like exaA2 and exaA3 . This would involve replacing the gene with an antibiotic resistance cassette (e.g., Smr/Spr or Kmr) and evaluating phenotypic changes.

  • Fluorescent protein fusions: Developing transcriptional gfp fusions with the azo1706 promoter to monitor expression under different conditions, similar to methods used for identifying alcohol dehydrogenase function in Azoarcus sp. strain BH72 .

  • Protein interaction studies: Identifying protein binding partners through co-immunoprecipitation, bacterial two-hybrid assays, or pull-down assays to establish the protein interaction network of azo1706 .

  • Microscopy studies: As a probable septation protein, fluorescence microscopy with tagged azo1706 would help visualize its subcellular localization during cell division.

  • Comparative phenotypic analysis: Comparing wildtype and azo1706 mutant strains for differences in cell morphology, division patterns, and plant colonization efficiency.

These approaches should be used complementarily to build a comprehensive understanding of azo1706 function in cellular processes and potentially in plant-microbe interactions.

What protein-protein interactions might be significant for azo1706 function?

While specific interacting partners for azo1706 have not been conclusively identified in the available literature, septation proteins typically function within complex protein networks that coordinate bacterial cell division. Research approaches to identify these interactions could include:

  • Pull-down assays using His-tagged recombinant azo1706: The available His-tagged recombinant protein can serve as bait to identify binding partners from Azoarcus lysates.

  • Bacterial two-hybrid screening: This system can identify direct protein-protein interactions in vivo.

  • Cross-linking coupled with mass spectrometry: This approach can capture transient interactions in the native cellular environment.

  • Co-immunoprecipitation with antibodies against azo1706: This technique can isolate protein complexes from bacterial lysates.

Potential interaction partners may include other cell division proteins, cytoskeletal elements, or regulatory proteins involved in controlling septation timing. Researchers should also investigate whether azo1706 interacts with components specific to endophytic lifestyle adaptation, as Azoarcus species show distinct genomic features related to plant association compared to soil-dwelling relatives .

What are optimal conditions for expressing and purifying recombinant azo1706?

Based on available recombinant protein production information , researchers should consider the following approach for optimal expression and purification of azo1706:

  • Expression system: E. coli has been successfully used as a host for expressing full-length azo1706 with a His-tag . BL21(DE3) or similar strains designed for protein expression are recommended.

  • Expression vector selection: Vectors with T7 or tac promoters provide controlled induction and typically yield good expression levels for bacterial proteins.

  • Induction conditions:

    • Temperature: 16-25°C often improves solubility

    • IPTG concentration: 0.1-0.5 mM typically sufficient

    • Induction time: 4-16 hours depending on temperature

  • Purification strategy:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resins for His-tagged protein

    • Buffer optimization to maintain protein stability (typically pH 7.5-8.0)

    • Consider including protease inhibitors during lysis

    • Optional secondary purification step using size exclusion chromatography

  • Quality control:

    • SDS-PAGE to confirm purity

    • Western blot to verify identity

    • Dynamic light scattering to assess homogeneity

    • Activity assays to confirm proper folding

When working with septation proteins, maintaining the native conformation is critical for functional studies. Researchers should test multiple buffer conditions to optimize protein stability and solubility.

How might azo1706 function relate to the nitrogen-fixing capabilities of Azoarcus?

While direct evidence linking azo1706 to nitrogen fixation is not present in the available literature, several indirect connections can be proposed and experimentally tested:

  • Cell division and colonization efficiency: As a probable septation protein, azo1706 may influence the rate and efficiency of bacterial proliferation within plant tissues, which could indirectly affect the total nitrogen-fixing capacity of the bacterial population .

  • Microaerobic adaptation: Nitrogen fixation in Azoarcus occurs under microaerobic conditions. If azo1706 plays a role in cell division under these specific conditions, it could be part of the adaptation machinery that enables nitrogen fixation .

  • Experimental approaches to test these hypotheses:

    • Measure nitrogenase activity in azo1706 mutants using acetylene reduction assays similar to those employed for Azoarcus sp. CIB

    • Compare plant growth promotion between plants inoculated with wildtype versus azo1706 mutant strains

    • Analyze expression of azo1706 under different nitrogen availability conditions

The table below outlines a proposed experimental design to assess nitrogenase activity in azo1706 mutants compared to wildtype, based on methodology used for Azoarcus sp. CIB :

StrainGrowth ConditionExpected Nitrogenase Activity (μmol C₂H₄/30 ml culture)Specific Activity (μmol C₂H₄g⁻¹ bacterial fresh weight 24h⁻¹)
WTMNF medium -NTo be determinedTo be determined
WTMNF medium +N (0.37 g/l NH₄Cl)To be determinedTo be determined
Δazo1706MNF medium -NTo be determinedTo be determined
Δazo1706MNF medium +N (0.37 g/l NH₄Cl)To be determinedTo be determined

How does azo1706 compare to intracellular septation proteins in other bacterial species?

Comparative analysis of azo1706 with septation proteins from other bacteria provides evolutionary context and potential functional insights:

  • Phylogenetic analysis: Construct phylogenetic trees of azo1706 homologs across bacterial species, with particular focus on:

    • Other endophytic bacteria

    • Other nitrogen-fixing bacteria

    • Model organisms with well-characterized cell division machinery

  • Structural comparison: While the 3D structure of azo1706 has not been reported, predictive modeling based on homologous proteins can identify conserved domains and motifs associated with septation functions.

  • Functional substitution experiments: Test whether azo1706 can complement septation defects in model organisms with mutations in homologous genes.

  • Expression pattern comparison: Compare expression patterns of azo1706 with known septation proteins in response to environmental and developmental cues.

This comparative approach should help determine whether azo1706 represents a specialized adaptation for endophytic lifestyle or a conserved component of bacterial cell division machinery.

What strategies can be employed to investigate azo1706's role in plant-microbe interactions?

Investigating azo1706's potential role in plant-microbe interactions requires integrating molecular, cellular, and ecological approaches:

  • Plant colonization assays:

    • Compare colonization patterns between wildtype and azo1706 mutant Azoarcus strains in rice and other grass hosts

    • Use fluorescently tagged strains to visualize colonization patterns through confocal microscopy

    • Quantify bacterial populations within different plant tissues using qPCR

  • Transcriptomic analysis:

    • RNA-seq to identify genes co-regulated with azo1706 during plant colonization

    • Compare expression profiles between free-living bacteria and plant-associated populations

    • Analyze expression under different plant-derived signals

  • Metabolic profiling:

    • Compare metabolite production between wildtype and azo1706 mutants during plant colonization

    • Identify plant metabolites that may influence azo1706 expression or function

  • Signal transduction investigation:

    • Determine if azo1706 expression is regulated by any known plant-responsive signaling systems

    • Investigate potential connections to redox-sensing systems like AccS that respond to environmental conditions in Azoarcus

Since Azoarcus sp. BH72 appears "disarmed" compared to plant pathogens, lacking many wall-degrading enzymes and typical pathogen secretion systems , understanding how cell division proteins like azo1706 may be specialized for non-pathogenic endophytic growth represents an important research direction.

How can advanced imaging techniques enhance our understanding of azo1706 function?

Advanced imaging approaches offer powerful tools for investigating septation protein dynamics and function:

  • Super-resolution microscopy:

    • Techniques such as PALM, STORM, or SIM can visualize azo1706 localization with nanometer precision

    • Sample preparation protocol:
      a. Fix Azoarcus cells with 4% paraformaldehyde
      b. Permeabilize with 0.1% Triton X-100
      c. Immunolabel with anti-azo1706 antibodies and fluorescent secondary antibodies
      d. Image using appropriate super-resolution platform

  • Time-lapse fluorescence microscopy:

    • Track GFP-tagged azo1706 during cell division cycle

    • Correlate localization patterns with septum formation

    • Investigate dynamics in response to environmental changes

  • Correlative light and electron microscopy (CLEM):

    • Combine fluorescence localization of azo1706 with ultrastructural context

    • Visualize relationship between azo1706 and membrane structures

  • FRET-based interaction studies:

    • Investigate protein-protein interactions in living cells

    • Identify spatial and temporal dynamics of interaction networks

These imaging approaches should be integrated with genetic and biochemical methods to develop a comprehensive understanding of azo1706 function in both laboratory cultures and during plant colonization.

What genomic and proteomic approaches could advance understanding of azo1706 regulation?

Future research on azo1706 regulation should leverage cutting-edge genomic and proteomic technologies:

  • ChIP-seq analysis:

    • Identify transcription factors that bind to the azo1706 promoter region

    • Map the binding sites precisely to understand regulatory mechanisms

    • Compare binding patterns under different environmental conditions

  • Ribosome profiling:

    • Measure translation efficiency of azo1706 mRNA under different conditions

    • Identify potential post-transcriptional regulatory mechanisms

  • Phosphoproteomics:

    • Determine if azo1706 undergoes phosphorylation as a regulatory mechanism

    • Identify kinases and phosphatases that might target azo1706

    • Connect to potential two-component signaling systems like AccSR

  • CRISPR interference (CRISPRi) screens:

    • Systematically repress other genes to identify genetic interactions with azo1706

    • Create conditional knockdowns to study essential gene interactions

  • Functional genomics comparative analysis:

    • Compare regulatory networks across different Azoarcus strains

    • Identify regulatory differences between plant-associated and free-living Azoarcus species

These approaches would help place azo1706 within the broader regulatory networks that control Azoarcus cell division, particularly in the context of plant colonization and endophytic lifestyle.

How might azo1706 contribute to the biotechnological applications of Azoarcus species?

Azoarcus species hold promise for agricultural biotechnology due to their nitrogen-fixing capabilities and plant growth-promoting properties. Understanding azo1706's role could contribute to these applications in several ways:

  • Optimizing plant colonization efficiency:

    • If azo1706 influences division rates during plant colonization, optimizing its expression could enhance the establishment of beneficial populations

    • Potential for genetic modification to improve colonization of non-host crops

  • Strain improvement strategies:

    • Target azo1706 and related septation proteins for directed evolution approaches

    • Select for variants with improved growth characteristics under agricultural conditions

  • Biomarker development:

    • Monitor azo1706 expression as an indicator of successful plant colonization

    • Use as a molecular marker for tracking engineered Azoarcus strains in field studies

  • Co-inoculation approaches:

    • Determine if azo1706 function influences compatibility with other beneficial microorganisms

    • Develop optimized microbial consortia for sustainable agriculture

Understanding the basic biology of cell division proteins like azo1706 provides a foundation for rational design of improved microbial biofertilizers with enhanced stability and effectiveness in agricultural settings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.