The amino acid sequence of azo1706 reveals hydrophobic regions and transmembrane domains, suggesting a role in membrane-associated processes. Key sequence segments include:
N-terminal: MKFFLDLLPVILFFVAYKFAGAAPDDSHALVAQFLGAGISPSQAPILIATAVAIAATLAQ
Mid-region: VLIVWLRHGKVDKMLWVSLAIITLFGGATLVFHNPTFIKWKPTVFYWTFAGALAVSALLF
C-terminal: RRNLVQKMLEAQIRLPAPVWQRLNLAWIGFFTLMGFLNLYVAYGYSEEAWVNFKLFGAMGLMLAFFLGQGFYLSRHLEEDAK
Structural Biology: Study of membrane protein folding and stability.
Cell Biology: Investigation of bacterial division mechanisms.
Biotechnology: Development of novel antibiotics targeting septation proteins.
Functional Studies: No published data on enzymatic activity or interaction partners.
Regulation: Unknown regulatory pathways or environmental triggers for expression.
Evolutionary Context: Limited comparative analysis with orthologs in other Azoarcus species.
KEGG: azo:azo1706
STRING: 62928.azo1706
Azo1706 is a protein identified in Azoarcus species, a genus of diazotrophic (nitrogen-fixing) Proteobacteria that commonly establishes associations with grass roots, particularly rice. Based on genomic annotation, this protein is classified as a "probable intracellular septation protein A," suggesting its involvement in bacterial cell division processes . The full-length protein consists of 202 amino acids and is available as a recombinant His-tagged protein expressed in E. coli for research purposes .
Azoarcus species are of significant research interest because they represent mutualistic endophytes that supply biologically fixed nitrogen to host plants without eliciting disease symptoms, making them important subjects for agricultural biotechnology studies . The azo1706 protein may play a role in the bacterial cell division processes that enable successful colonization of plant tissues.
The azo1706 gene is encoded within the Azoarcus genome, which in the well-studied strain BH72 consists of 4,376,040 base pairs and contains 3,992 predicted protein-coding sequences . While specific information about the genomic neighborhood of azo1706 is limited in current research literature, Azoarcus genomes are notable for containing remarkably few mobile elements, indicating a low rate of recent gene transfer . This genomic stability is thought to reflect adaptation to a stable, low-stress microenvironment within plant hosts.
When studying azo1706's genomic context, researchers should consider:
Operon structure and co-transcribed genes
Conserved gene neighborhoods across Azoarcus strains
Presence of regulatory elements in the promoter region
Evolutionary conservation compared to soil-dwelling versus plant-associated Azoarcus strains
Comparative genomic approaches between Azoarcus species can provide insights into the evolutionary importance of azo1706, particularly between endophytic strains like BH72 and soil-dwelling species like A. tolulyticus and A. evansii .
Determining the function of azo1706 requires a multi-faceted experimental approach:
Gene knockouts/disruptions: Creating azo1706 deletion mutants in Azoarcus sp. using marker exchange mutagenesis similar to approaches used for other Azoarcus genes like exaA2 and exaA3 . This would involve replacing the gene with an antibiotic resistance cassette (e.g., Smr/Spr or Kmr) and evaluating phenotypic changes.
Fluorescent protein fusions: Developing transcriptional gfp fusions with the azo1706 promoter to monitor expression under different conditions, similar to methods used for identifying alcohol dehydrogenase function in Azoarcus sp. strain BH72 .
Protein interaction studies: Identifying protein binding partners through co-immunoprecipitation, bacterial two-hybrid assays, or pull-down assays to establish the protein interaction network of azo1706 .
Microscopy studies: As a probable septation protein, fluorescence microscopy with tagged azo1706 would help visualize its subcellular localization during cell division.
Comparative phenotypic analysis: Comparing wildtype and azo1706 mutant strains for differences in cell morphology, division patterns, and plant colonization efficiency.
These approaches should be used complementarily to build a comprehensive understanding of azo1706 function in cellular processes and potentially in plant-microbe interactions.
While specific interacting partners for azo1706 have not been conclusively identified in the available literature, septation proteins typically function within complex protein networks that coordinate bacterial cell division. Research approaches to identify these interactions could include:
Pull-down assays using His-tagged recombinant azo1706: The available His-tagged recombinant protein can serve as bait to identify binding partners from Azoarcus lysates.
Bacterial two-hybrid screening: This system can identify direct protein-protein interactions in vivo.
Cross-linking coupled with mass spectrometry: This approach can capture transient interactions in the native cellular environment.
Co-immunoprecipitation with antibodies against azo1706: This technique can isolate protein complexes from bacterial lysates.
Potential interaction partners may include other cell division proteins, cytoskeletal elements, or regulatory proteins involved in controlling septation timing. Researchers should also investigate whether azo1706 interacts with components specific to endophytic lifestyle adaptation, as Azoarcus species show distinct genomic features related to plant association compared to soil-dwelling relatives .
Based on available recombinant protein production information , researchers should consider the following approach for optimal expression and purification of azo1706:
Expression system: E. coli has been successfully used as a host for expressing full-length azo1706 with a His-tag . BL21(DE3) or similar strains designed for protein expression are recommended.
Expression vector selection: Vectors with T7 or tac promoters provide controlled induction and typically yield good expression levels for bacterial proteins.
Induction conditions:
Temperature: 16-25°C often improves solubility
IPTG concentration: 0.1-0.5 mM typically sufficient
Induction time: 4-16 hours depending on temperature
Purification strategy:
Immobilized metal affinity chromatography (IMAC) using Ni-NTA resins for His-tagged protein
Buffer optimization to maintain protein stability (typically pH 7.5-8.0)
Consider including protease inhibitors during lysis
Optional secondary purification step using size exclusion chromatography
Quality control:
SDS-PAGE to confirm purity
Western blot to verify identity
Dynamic light scattering to assess homogeneity
Activity assays to confirm proper folding
When working with septation proteins, maintaining the native conformation is critical for functional studies. Researchers should test multiple buffer conditions to optimize protein stability and solubility.
While direct evidence linking azo1706 to nitrogen fixation is not present in the available literature, several indirect connections can be proposed and experimentally tested:
Cell division and colonization efficiency: As a probable septation protein, azo1706 may influence the rate and efficiency of bacterial proliferation within plant tissues, which could indirectly affect the total nitrogen-fixing capacity of the bacterial population .
Microaerobic adaptation: Nitrogen fixation in Azoarcus occurs under microaerobic conditions. If azo1706 plays a role in cell division under these specific conditions, it could be part of the adaptation machinery that enables nitrogen fixation .
Experimental approaches to test these hypotheses:
Measure nitrogenase activity in azo1706 mutants using acetylene reduction assays similar to those employed for Azoarcus sp. CIB
Compare plant growth promotion between plants inoculated with wildtype versus azo1706 mutant strains
Analyze expression of azo1706 under different nitrogen availability conditions
The table below outlines a proposed experimental design to assess nitrogenase activity in azo1706 mutants compared to wildtype, based on methodology used for Azoarcus sp. CIB :
| Strain | Growth Condition | Expected Nitrogenase Activity (μmol C₂H₄/30 ml culture) | Specific Activity (μmol C₂H₄g⁻¹ bacterial fresh weight 24h⁻¹) |
|---|---|---|---|
| WT | MNF medium -N | To be determined | To be determined |
| WT | MNF medium +N (0.37 g/l NH₄Cl) | To be determined | To be determined |
| Δazo1706 | MNF medium -N | To be determined | To be determined |
| Δazo1706 | MNF medium +N (0.37 g/l NH₄Cl) | To be determined | To be determined |
Comparative analysis of azo1706 with septation proteins from other bacteria provides evolutionary context and potential functional insights:
Phylogenetic analysis: Construct phylogenetic trees of azo1706 homologs across bacterial species, with particular focus on:
Other endophytic bacteria
Other nitrogen-fixing bacteria
Model organisms with well-characterized cell division machinery
Structural comparison: While the 3D structure of azo1706 has not been reported, predictive modeling based on homologous proteins can identify conserved domains and motifs associated with septation functions.
Functional substitution experiments: Test whether azo1706 can complement septation defects in model organisms with mutations in homologous genes.
Expression pattern comparison: Compare expression patterns of azo1706 with known septation proteins in response to environmental and developmental cues.
This comparative approach should help determine whether azo1706 represents a specialized adaptation for endophytic lifestyle or a conserved component of bacterial cell division machinery.
Investigating azo1706's potential role in plant-microbe interactions requires integrating molecular, cellular, and ecological approaches:
Plant colonization assays:
Compare colonization patterns between wildtype and azo1706 mutant Azoarcus strains in rice and other grass hosts
Use fluorescently tagged strains to visualize colonization patterns through confocal microscopy
Quantify bacterial populations within different plant tissues using qPCR
Transcriptomic analysis:
RNA-seq to identify genes co-regulated with azo1706 during plant colonization
Compare expression profiles between free-living bacteria and plant-associated populations
Analyze expression under different plant-derived signals
Metabolic profiling:
Compare metabolite production between wildtype and azo1706 mutants during plant colonization
Identify plant metabolites that may influence azo1706 expression or function
Signal transduction investigation:
Since Azoarcus sp. BH72 appears "disarmed" compared to plant pathogens, lacking many wall-degrading enzymes and typical pathogen secretion systems , understanding how cell division proteins like azo1706 may be specialized for non-pathogenic endophytic growth represents an important research direction.
Advanced imaging approaches offer powerful tools for investigating septation protein dynamics and function:
Super-resolution microscopy:
Techniques such as PALM, STORM, or SIM can visualize azo1706 localization with nanometer precision
Sample preparation protocol:
a. Fix Azoarcus cells with 4% paraformaldehyde
b. Permeabilize with 0.1% Triton X-100
c. Immunolabel with anti-azo1706 antibodies and fluorescent secondary antibodies
d. Image using appropriate super-resolution platform
Time-lapse fluorescence microscopy:
Track GFP-tagged azo1706 during cell division cycle
Correlate localization patterns with septum formation
Investigate dynamics in response to environmental changes
Correlative light and electron microscopy (CLEM):
Combine fluorescence localization of azo1706 with ultrastructural context
Visualize relationship between azo1706 and membrane structures
FRET-based interaction studies:
Investigate protein-protein interactions in living cells
Identify spatial and temporal dynamics of interaction networks
These imaging approaches should be integrated with genetic and biochemical methods to develop a comprehensive understanding of azo1706 function in both laboratory cultures and during plant colonization.
Future research on azo1706 regulation should leverage cutting-edge genomic and proteomic technologies:
ChIP-seq analysis:
Identify transcription factors that bind to the azo1706 promoter region
Map the binding sites precisely to understand regulatory mechanisms
Compare binding patterns under different environmental conditions
Ribosome profiling:
Measure translation efficiency of azo1706 mRNA under different conditions
Identify potential post-transcriptional regulatory mechanisms
Phosphoproteomics:
CRISPR interference (CRISPRi) screens:
Systematically repress other genes to identify genetic interactions with azo1706
Create conditional knockdowns to study essential gene interactions
Functional genomics comparative analysis:
These approaches would help place azo1706 within the broader regulatory networks that control Azoarcus cell division, particularly in the context of plant colonization and endophytic lifestyle.
Azoarcus species hold promise for agricultural biotechnology due to their nitrogen-fixing capabilities and plant growth-promoting properties. Understanding azo1706's role could contribute to these applications in several ways:
Optimizing plant colonization efficiency:
If azo1706 influences division rates during plant colonization, optimizing its expression could enhance the establishment of beneficial populations
Potential for genetic modification to improve colonization of non-host crops
Strain improvement strategies:
Target azo1706 and related septation proteins for directed evolution approaches
Select for variants with improved growth characteristics under agricultural conditions
Biomarker development:
Monitor azo1706 expression as an indicator of successful plant colonization
Use as a molecular marker for tracking engineered Azoarcus strains in field studies
Co-inoculation approaches:
Determine if azo1706 function influences compatibility with other beneficial microorganisms
Develop optimized microbial consortia for sustainable agriculture
Understanding the basic biology of cell division proteins like azo1706 provides a foundation for rational design of improved microbial biofertilizers with enhanced stability and effectiveness in agricultural settings.