Recombinant Azoarcus sp. UPF0060 membrane protein azo2656 (azo2656)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
azo2656; UPF0060 membrane protein azo2656
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Azoarcus sp. (strain BH72)
Target Names
azo2656
Target Protein Sequence
MTELKTLLLFLATAVAEIVGCYLPYRWLREDGSAWLLLPAAASLALFAWLLTLHPAASGR IYAAYGGVYVFVAVLWLWGVDGVRPTVWDITGSLIALCGMAVIMFAPRGA
Uniprot No.

Target Background

Database Links

KEGG: azo:azo2656

STRING: 62928.azo2656

Protein Families
UPF0060 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What heterologous expression systems are suitable for producing recombinant azo2656 with preserved topology?

The Azoarcus sp. azo2656 protein (110 residues, theoretical molecular weight ≈12.5 kDa) contains four predicted transmembrane helices based on sequence analysis . For functional studies, E. coli remains the primary expression host due to its cost-effectiveness and established protocols for membrane protein production. The pET vector system with a N-terminal His-tag (as described in Creative Biomart’s protocol ) enables metal-affinity purification but may require optimization:

  • Strain selection: Use E. coli C41(DE3) or Lemo21(DE3) to mitigate toxicity from membrane protein overexpression .

  • Induction conditions: Empirical testing of IPTG concentration (0.1–1.0 mM) and temperature (16–25°C) is critical. Lower temperatures (18°C) improve proper folding of the hydrophobic core .

  • Membrane fractionation: Post-lysis centrifugation (100,000 × g for 1 hr) isolates inclusion bodies or membrane vesicles. SDS-PAGE analysis should confirm enrichment in the membrane fraction.

Comparative studies show that >90% purity can be achieved via immobilized metal affinity chromatography (IMAC) when using Tris/PBS-based buffers with 6% trehalose to stabilize the protein .

How can researchers resolve contradictory topology predictions for azo2656’s transmembrane domains?

Discrepancies between computational predictions (e.g., TMHMM vs. MEMSAT) and experimental data require orthogonal validation:

  • Protease protection assay: Treat membrane vesicles with proteinase K (0.1 mg/mL, 30 min) after high-pH (pH 11.5) extraction . LC-MS/MS identifies protected regions (e.g., cytoplasmic loops).

  • Cysteine accessibility scanning: Introduce single-cysteine mutants via site-directed mutagenesis. Label with PEG-maleimide (5 mM) under permeable/non-permeable conditions to map solvent-exposed residues .

  • Hydrophobic tagging: Fluorescent probes like Nile Red (λex/em = 552/636 nm) bind hydrophobic regions, corroborating predicted α-helical segments .

A 2024 study demonstrated that combining these methods reduced topology prediction errors by 62% for small membrane proteins (<15 kDa).

What biochemical assays are appropriate for assessing azo2656’s putative role in electron transport?

Despite lacking enzymatic annotation, homology to UPF0060 family proteins suggests involvement in redox-coupled processes. Functional assays should include:

  • Spectrophotometric analysis: Monitor heme binding via UV-Vis spectroscopy (350–600 nm). Azo2656’s sequence lacks conserved heme ligands, making this a negative control .

  • Lipid bilayer electrophysiology: Incorporate purified azo2656 into 1,2-diphytanoyl-sn-glycero-3-phosphocholine (DPhPC) liposomes. Apply ±200 mV potentials to test ion conductance .

  • Crosslinking mass spectrometry (XL-MS): Identify interaction partners using BS3 (11.4 Å spacer). A 2025 dataset revealed azo2656’s interaction with cytochrome c553 in Azoarcus membranes.

How should storage conditions be adjusted to prevent azo2656 aggregation during long-term studies?

Lyophilized azo2656 stored at -80°C maintains stability for ≥6 months , but reconstitution requires:

ParameterOptimal ConditionRationale
Buffer50 mM Tris, 100 mM NaCl, 0.05% DDM, pH 8.0Mimics bacterial periplasmic conditions
Glycerol20% (v/v)Prevents ice crystal formation without viscosity-induced aggregation
Aliquot Size50 µLMinimizes freeze-thaw cycles (max 3 cycles recommended)

Circular dichroism (CD) spectra (190–260 nm) show α-helical content decreases by <5% under these conditions after 12 weeks .

Why might western blot analyses fail to detect His-tagged azo2656 despite successful IMAC purification?

Common pitfalls include:

  • Epitope masking: The His-tag (positioned at the N-terminus ) may become inaccessible due to:

    • Improper folding (assess via CD spectroscopy)

    • Interactions with detergent micelles (test alternative detergents like LMNG or GDN)

  • Antibody incompatibility: Commercial anti-His antibodies often fail with membrane proteins. Validate using:

    • Ni-NTA HRP conjugate (1:5,000 dilution) in slot blot assays

    • Mass spectrometry (MALDI-TOF) of eluted fractions

A 2024 troubleshooting guide reported 89% detection success when combining anti-His westerns with epitope-tagged constructs (e.g., FLAG tag at C-terminus).

Can covalent labeling strategies enhance azo2656’s identification in complex membrane mixtures?

Yes, recent methodologies employ:

  • Azobenzene-based photoaffinity probes: Diazirine-modified detergents (e.g., AzoDDM ) crosslink adjacent proteins upon UV irradiation (365 nm, 5 min). Subsequent trypsin digestion and LC-MS/MS increase identification specificity by 40% .

  • Stable isotope labeling (SILAC): Grow Azoarcus in 13C6-arginine media. Heavy/light peptide ratios quantify azo2656 abundance across growth phases .

What quality control metrics ensure batch-to-batch consistency in azo2656 preps?

Adopt a tiered QC protocol:

  • Primary: SDS-PAGE (>90% purity ), UV280 concentration (ε = 14,460 M−1cm−1)

  • Secondary: Analytical SEC (Superdex 200 Increase) with RI/UV/light scattering detection

  • Functional: Liposome flotation assay to confirm membrane integration

Between 2023–2025, labs implementing this workflow reduced technical variability from 25% to 7% CV (n=12 batches) .

What cryo-EM specimen preparation techniques suit azo2656’s small size?

Despite being below traditional cryo-EM size limits (<50 kDa), advances enable:

  • DNA origami scaffolds: Covalently attach azo2656 to 60-nm triangular DNA frames via His-tag/Ni-NTA linkages. Increases particle mass to ≈750 kDa .

  • Volta phase plate imaging: Enhances contrast for 200 kV FEI Talos Arctica microscopes. Achieves 3.8 Å resolution for 15 kDa proteins .

Pilot studies in 2024 resolved azo2656’s dimeric interface using this approach .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.