Recombinant Azorhizobium caulinodans Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant cobS is produced via heterologous expression in E. coli, followed by affinity chromatography using the His tag. Critical protocols include:

  • Reconstitution: Lyophilized protein is reconstituted in sterile water (0.1–1.0 mg/mL) with 5–50% glycerol for long-term storage .

  • Stability: Repeated freeze-thaw cycles are discouraged; working aliquots stored at 4°C retain activity for one week .

Functional Role in Cobalamin Biosynthesis

CobS catalyzes the attachment of the lower ligand (ribazole) to adenosylcobinamide-GDP, forming adenosylcobalamin. This step is critical for:

  • Nitrogen fixation in A. caulinodans, which forms symbiotic nodules on Sesbania rostrata roots and stems under flood-prone conditions .

  • Bacterial chemotaxis and root colonization, processes linked to symbiotic efficiency .

Genomic and Regulatory Context

The cobS gene is part of the A. caulinodans ORS571 genome, which encodes dual nitrogen-fixing capabilities (free-living and symbiotic) . Regulatory mechanisms, such as lysine acetylation, may modulate cobS activity, as observed in other A. caulinodans proteins .

Research Applications

  • Enzyme Kinetics: Study substrate specificity and inhibition using purified recombinant cobS .

  • Symbiosis Studies: Investigate cobS’s role in rhizobial-host interactions through gene knockout models .

  • Structural Biology: Analyze 3D architecture to design cobalamin biosynthesis inhibitors .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cobS; AZC_2896; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-264
Protein Length
full length protein
Species
Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)
Target Names
cobS
Target Protein Sequence
MRHSRILADVGAALRFYSRIPVPAGAAEDAFAPPDLKRIAYAVPLAGAAIGLAGAAILIG AHALGLPNLVAAILAVLTCVLLTGALHEDGLADTADGFGGGASRLRRLEIMRDSRIGSYG ACALVFSLLLRVALLDGLLALSPTRAALALIAAASLSRAAGMLLLEFLPPARADGASAAA GQPGADAAVRSALVGALLATLLIVPSTGVGATLMAIGLSVLALFAMTRLSNRLIGGQTGD VAGAVQQLCEIAFLMGVLIYARPH
Uniprot No.

Target Background

Function
Catalyzes the synthesis of adenosylcobalamin (Ado-cobalamin) from adenosylcobinamide-GDP and α-ribazole. It also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and α-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Azorhizobium caulinodans and why is it significant in microbiological research?

Azorhizobium caulinodans ORS571 is a soil bacterium that uniquely fixes nitrogen both in free-living conditions and in symbiotic relationships with the leguminous plant Sesbania rostrata. This relationship is particularly important for wetland improvement as S. rostrata serves as a pioneer plant in these environments . A. caulinodans forms nitrogen-fixing nodules not only on the roots but also on the stems of its host plant, making it an exceptional model organism for studying plant-microbe interactions . The bacterium employs complex regulatory mechanisms to adapt to these different lifestyles, including chemotaxis systems for plant root colonization and specialized nitrogen fixation pathways .

What role does cobalamin (vitamin B12) play in bacterial metabolism?

Cobalamin serves as an essential cofactor for various enzymes involved in critical metabolic processes. In bacteria like A. caulinodans, cobalamin-dependent enzymes participate in carbon metabolism, amino acid synthesis, and potentially in processes supporting nitrogen fixation. Cobalamin exists in multiple oxidation states, including Cob(I), His-on Cob(II), and CH3-Cob(III), each with distinctive spectroscopic properties that can be monitored at specific wavelengths (~390 nm, ~477 nm, and ~528 nm respectively) . These different forms undergo conformational changes that are critical for their biological function, particularly in enzymes involved in methyl transfer reactions.

What is cobalamin synthase (CobS) and how does it function in the cobalamin biosynthetic pathway?

Cobalamin synthase (CobS) catalyzes one of the final steps in the vitamin B12 biosynthetic pathway, specifically the incorporation of cobalt into the corrin ring structure. This enzyme is crucial for producing functional cobalamin molecules that can serve as cofactors. While not directly described in the search results, CobS would likely be essential for A. caulinodans to produce the cobalamin needed for various metabolic processes, including those that support nitrogen fixation and potentially chemotaxis. The activity of this enzyme may be regulated by post-translational modifications such as acetylation, which has been shown to regulate protein function in A. caulinodans .

What are the optimal expression systems for recombinant A. caulinodans CobS?

For recombinant expression of A. caulinodans CobS, researchers should consider the oxygen sensitivity of cobalamin-processing enzymes. Based on protocols used for similar cobalamin-binding proteins, expression systems must account for the potential oxygen sensitivity of CobS and its products. For highly oxygen-sensitive proteins like those in the Cob(I) state, an anoxic setup with sample loading, pumps, and waste lines contained in an in-line anoxic chamber would be necessary . Temperature, induction conditions, and host strain selection are critical factors that would need optimization for successful expression of functional CobS.

How can researchers ensure proper folding and activity of recombinant CobS?

To ensure proper folding and activity of recombinant CobS, researchers should monitor the oxidation state and structural integrity throughout the purification process. For cobalamin-related proteins, UV-Vis absorption spectroscopy can verify the integrity of different oxidation states, as demonstrated with His-on Cob(II) (peak at ~477 nm), CH3-Cob(III) (peak at ~528 nm), and Cob(I) (peak at ~390 nm) . Additionally, batch-mode experiments may be necessary when certain substrates are not readily available in large quantities, offering greater control over verifying sample oxidation state integrity. For photosensitive forms like CH3-Cob(III), experiments must be conducted in darkened conditions with limited red light illumination to prevent photolysis or photoreduction .

What purification strategies are most effective for recombinant CobS?

Effective purification of recombinant CobS would likely require a multi-step approach similar to that used for other cobalamin-binding proteins. This might include affinity chromatography followed by size exclusion chromatography. When dealing with oxygen-sensitive forms, specialized setups are necessary. For example, in studies of cobalamin-binding proteins, some oxidation states required a fully anoxic setup where sample loading, pumps, and waste lines were contained in an anoxic chamber at the beamline . UV-Vis spectroscopy should be performed before and after each purification step to ensure that the desired oxidation state is maintained throughout the process.

How can researchers assess the enzymatic activity of recombinant CobS?

To assess CobS enzymatic activity, researchers should develop assays that monitor substrate consumption or product formation. Spectrophotometric methods can detect changes in absorption spectra as cobalamin transitions between oxidation states (Cob(I), Cob(II), and CH3-Cob(III)), which have characteristic absorption peaks at ~390 nm, ~477 nm, and ~528 nm respectively . For more sensitive detection, mass spectrometry or HPLC-based methods could quantify cobalamin production. When establishing these assays, researchers must be mindful of the oxygen sensitivity of certain cobalamin forms and potentially conduct experiments under anoxic conditions, especially when working with the highly oxygen-sensitive Cob(I) state .

What structural techniques are appropriate for studying CobS conformational changes?

Small-angle X-ray scattering (SAXS) has proven effective for studying conformational changes in cobalamin-binding proteins and would be appropriate for CobS. Both SEC-SAXS (size exclusion chromatography coupled with SAXS) and batch-mode SAXS experiments can provide insights into structural differences between oxidation states . Batch mode may be particularly useful when certain substrates are not available in quantities sufficient for SEC-SAXS running buffers. When conducting these experiments, UV-Vis absorption spectra should be collected before and after X-ray exposure to monitor any changes in cobalamin oxidation state . For highly oxygen-sensitive forms like Cob(I), a fully anoxic experimental setup would be necessary.

How might post-translational modifications affect CobS activity?

Acetylation has been identified as an important modification that regulates protein function in A. caulinodans ORS571 and could potentially influence CobS activity . A systematic analysis of the A. caulinodans acetylome revealed acetylation of various proteins, including those involved in chemotaxis . To investigate potential acetylation of CobS, researchers could employ mass spectrometry-based proteomics approaches similar to those used in acetylome-wide studies of A. caulinodans. Site-directed mutagenesis of potential acetylation sites could then be performed to assess the functional consequences on enzyme activity. Understanding these modifications could provide insights into how the bacterium regulates cobalamin synthesis in response to environmental conditions.

How might CobS activity relate to the nitrogen fixation capacity of A. caulinodans?

While the direct relationship between CobS and nitrogen fixation is not addressed in the search results, cobalamin-dependent enzymes may play important roles in the metabolic processes supporting nitrogen fixation. A. caulinodans has the dual capacity to fix nitrogen both as a free-living organism and in symbiosis with S. rostrata . This dual lifestyle requires fine-tuned regulation of various physiological mechanisms, including those potentially dependent on cobalamin. Research approaches to investigate this relationship could include comparing CobS expression and activity between free-living and symbiotic states, creating CobS knockout mutants to assess effects on nitrogen fixation, and measuring cobalamin levels under different nitrogen-fixing conditions.

What is the potential relationship between cobalamin synthesis and chemotaxis in A. caulinodans?

Chemotaxis and motility enable A. caulinodans to swim toward plant-derived attractants and colonize root surfaces, providing a competitive advantage for nodule formation . The A. caulinodans genome encodes a complex chemotactic system with 43 chemoreceptors and multiple chemotaxis proteins including CheA, CheW, CheZ, CheB, CheR, and two CheY variants . While the direct relationship between cobalamin synthesis and chemotaxis is not established in the search results, cobalamin-dependent methyltransferases could potentially influence signaling pathways involved in chemotaxis. Additionally, acetylation has been demonstrated to regulate chemotaxis proteins in A. caulinodans , suggesting that similar post-translational modifications might coordinate cobalamin synthesis and chemotactic responses.

How does the unusual chemotaxis system of A. caulinodans potentially interact with cobalamin-dependent processes?

A. caulinodans possesses an unusual chemotaxis system with two response regulators (CheY1 and CheY2) that mediate bacterial chemotaxis and motility in different ways . CheY1 is encoded within the main chemotaxis cluster (cheAWY1BR), while CheY2 is located 37 kb upstream . Studies have shown that both play roles in chemotaxis, with CheY2 having a more prominent role . The A. caulinodans CheA protein structure is striking due to additional C-terminal CheW and receiver domains, which is unusual compared to other alphaproteobacteria . Research could investigate whether cobalamin or its synthesis enzymes like CobS interact with this unique chemotaxis system, potentially through cobalamin-dependent methyltransferases that might modify chemotaxis proteins.

How can researchers investigate conformational dynamics of CobS using cutting-edge techniques?

To investigate CobS conformational dynamics, researchers can employ approaches similar to those used for other cobalamin-binding proteins. SAXS experiments (both SEC-SAXS and batch-mode) can provide insights into structural differences between oxidation states and substrate-bound forms . For batch-mode experiments, UV-Vis absorption spectra should be collected before and after X-ray exposure to verify sample integrity. Different experimental setups would be required depending on the oxidation state being studied: standard setups for His-on Cob(II), darkened conditions with red light only for photosensitive CH3-Cob(III), and fully anoxic setups for oxygen-sensitive Cob(I) . Computational approaches like molecular dynamics simulations could complement experimental data to provide atomic-level insights into conformational transitions.

What roles might regulatory proteins like Lon protease play in controlling CobS expression or activity?

Lon protease has been shown to play critical roles in A. caulinodans, particularly in symbiotic nitrogen fixation with S. rostrata . While not directly linked to CobS in the search results, Lon protease is involved in suppressing the expression of reb genes and regulating exopolysaccharide production in A. caulinodans . This suggests that Lon might also regulate CobS or other cobalamin synthesis enzymes, either directly through protein degradation or indirectly through effects on gene expression. Research approaches could include comparing CobS protein levels and activity in wild-type versus lon mutant strains, and investigating whether stress conditions that activate Lon affect cobalamin synthesis.

How might acetylation patterns across the A. caulinodans proteome inform our understanding of CobS regulation?

Systematic analysis of the A. caulinodans acetylome has revealed diverse functions of this post-translational modification, including roles in chemotaxis . The study identified acetylated proteins involved in various cellular processes, providing insights into regulatory mechanisms of rhizobial physiology. Similar approaches could be applied to investigate potential acetylation of CobS and other cobalamin synthesis enzymes. Research methods could include acetylome-wide identification of acetylated residues on CobS, clustering analyses to identify patterns across related proteins, and characterization of upstream acetylation-regulating enzymes. Such studies would provide new insights into how A. caulinodans regulates cobalamin synthesis in response to environmental conditions.

What precautions are necessary when handling oxygen-sensitive forms of cobalamin during CobS research?

Working with oxygen-sensitive forms of cobalamin requires specific precautions, as demonstrated in studies of cobalamin-binding proteins. For the highly oxygen-sensitive Cob(I) form, a fully anoxic setup is necessary, where sample loading, pumps, and waste lines are contained in an in-line anoxic chamber . UV-Vis spectroscopy should be used to verify the oxidation state before and after experiments, with specific characteristic peaks (~390 nm for Cob(I), ~477 nm for Cob(II), and ~528 nm for CH3-Cob(III)) . For photosensitive forms like CH3-Cob(III), experiments must be conducted in darkened conditions with limited red light illumination to prevent photolysis or photoreduction . These precautions ensure the integrity of the samples throughout experimental procedures.

What experimental design considerations are important when comparing CobS activity in free-living versus symbiotic states?

When comparing CobS activity between free-living and symbiotic states, researchers should consider the distinct environmental conditions of each state. A. caulinodans can fix nitrogen both as a free-living organism and in symbiosis with S. rostrata , but these states involve different physiological demands. Experimental designs should account for factors like oxygen levels (generally lower in nodules), pH conditions, nutrient availability, and potential plant-derived signals. Approaches might include isolating bacteria from different states for in vitro enzyme assays, developing reporter systems to monitor CobS expression in situ, and creating mutants with altered CobS activity to assess effects on both free-living growth and symbiotic nitrogen fixation.

What analytical techniques are most appropriate for quantifying cobalamin production in A. caulinodans?

For quantifying cobalamin production in A. caulinodans, multiple analytical techniques should be considered. UV-Vis spectroscopy can identify different cobalamin forms based on characteristic absorption peaks (~390 nm for Cob(I), ~477 nm for Cob(II), and ~528 nm for CH3-Cob(III)) . For more precise quantification, HPLC or LC-MS methods could separate and quantify different cobalamin species. When implementing these techniques, researchers must consider the oxygen sensitivity of certain cobalamin forms, potentially conducting analyses under anoxic conditions. Additionally, batch-mode approaches might be necessary when dealing with limited substrate availability . These analytical approaches would allow researchers to compare cobalamin production under different physiological conditions or in different genetic backgrounds.

What key parameters should be considered when designing experiments with recombinant A. caulinodans CobS?

ParameterMethodological ConsiderationsReference
Oxidation state monitoringUV-Vis spectroscopy with specific wavelengths for different oxidation states: ~390 nm (Cob(I)), ~477 nm (Cob(II)), ~528 nm (CH3-Cob(III))
Oxygen sensitivityFully anoxic setup required for Cob(I); standard conditions acceptable for Cob(II); darkened conditions needed for photosensitive CH3-Cob(III)
Substrate availabilityBatch-mode experiments may be necessary when substrates are limited
Post-translational modificationsAcetylation may regulate enzyme activity; analysis using mass spectrometry recommended
Environmental conditionsDifferent conditions for free-living vs. symbiotic states; adaptation to wetland environments
Genetic backgroundConsider potential regulatory effects of proteins like Lon protease

How does the chemotaxis system of A. caulinodans compare to other bacteria, and what implications might this have for cobalamin-related research?

FeatureA. caulinodansOther BacteriaPotential Implications for Cobalamin Research
Response regulatorsTwo variants (CheY1 and CheY2) with different roles and locationsOften single CheYMultiple regulatory pathways that might interact with cobalamin-dependent processes
CheA structureUnusual domain architecture with additional C-terminal CheW and receiver domainsTypically lacks these additional domainsUnique regulatory mechanisms that might involve cobalamin-dependent methyltransferases
Genomic organizationOne chemotaxis cluster (cheAWY1BR) plus two independent genes (cheY2, cheZ)Often multiple clusters or single complete clusterDistinct evolutionary history that might reflect specialized metabolism including cobalamin synthesis
Chemoreceptors43 chemoreceptorsVariable numbersDiverse sensing capabilities that might include cobalamin or its precursors
RegulationAcetylation involved in chemotaxis regulationVarious mechanismsPotential for shared regulatory mechanisms between chemotaxis and cobalamin synthesis
FunctionImportant for colonization of plant root surfacesVarious roles depending on speciesCritical process that might be coordinated with cobalamin-dependent metabolism during symbiosis

What differential expression patterns might be expected for cobS under various physiological conditions?

Based on expression patterns of other genes in A. caulinodans, researchers might anticipate differential regulation of cobS under various conditions. While specific data on cobS expression is not provided in the search results, the following table presents a framework for investigation based on known regulatory patterns in this organism:

Physiological ConditionExpected cobS Expression PatternExperimental ApproachRationale
Free-living vs. symbiotic statePotentially upregulated during symbiosisqRT-PCR analysis comparing expression levels between statesA. caulinodans shows different gene expression patterns between free-living and symbiotic states
Oxygen availabilityLikely affected by oxygen levelsGene expression analysis under aerobic vs. microaerobic conditionsCobalamin synthesis involves oxygen-sensitive steps; nitrogen fixation requires low oxygen
Nitrogen availabilityPossible coordination with nitrogen fixation genesMonitor expression in nitrogen-replete vs. nitrogen-limited conditionsCobalamin-dependent enzymes may support nitrogen metabolism
Plant-derived signalsPotential response to host compoundsExpression analysis with plant exudates or purified signal moleculesA. caulinodans responds to plant signals during colonization and nodulation
Stress conditionsMay be regulated during stressExpression studies under various stresses (oxidative, pH, osmotic)Stress response often involves global regulators like Lon protease
Growth phasePossibly growth phase-dependentTime-course expression analysisMetabolic needs change throughout bacterial growth cycle

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.