Recombinant Azorhizobium caulinodans NADH-quinone oxidoreductase subunit K (nuoK)

What is NADH-quinone oxidoreductase subunit K (nuoK) in Azorhizobium caulinodans?

NADH-quinone oxidoreductase subunit K (nuoK) is a component of the respiratory chain complex I in Azorhizobium caulinodans. This protein is encoded by the nuoK gene (AZC_1678) and functions as part of the NADH dehydrogenase I complex . The nuoK protein consists of 102 amino acids with a sequence of MEIGLSHYLTVAAILFTMGTLGIFLNRKNVIVILMSVELILLAVNINLVAFSAFQGNLVGQVFALLVLTVAAAEAAIGLAILVVFFRNRGSIAVEDINAMKG . It plays a critical role in energy metabolism by participating in electron transfer reactions that couple NADH oxidation to quinone reduction, ultimately contributing to the establishment of a proton gradient for ATP synthesis.

What is the relationship between NADH-quinone oxidoreductase and nitrogen fixation in A. caulinodans?

Nitrogen fixation is an energetically demanding process that requires substantial ATP. In A. caulinodans, which can fix nitrogen in both free-living and symbiotic states, efficient energy generation is crucial. NADH-quinone oxidoreductase, as part of the respiratory chain, plays an important role in energy conservation by coupling electron transfer to proton translocation.

Research shows that under nitrogen-fixing conditions, A. caulinodans exhibits specific metabolic adaptations. When grown under nitrogen-limiting conditions, the bacterium can enter a free-living nitrogen fixation state, especially under hypoxia, where energy metabolism must be precisely regulated . The expression and activity of respiratory chain components, including nuoK, may be adjusted to meet the high energy demands of nitrogen fixation while managing oxygen levels, as nitrogenase is oxygen-sensitive.

How is recombinant A. caulinodans nuoK typically produced for research purposes?

Recombinant A. caulinodans nuoK protein can be produced using an E. coli expression system. The full-length protein (1-102aa) is typically fused to an N-terminal His tag to facilitate purification . The expression conditions should be optimized for membrane proteins, as nuoK is a transmembrane protein.

The methodological approach includes:

• Cloning the nuoK gene into an appropriate expression vector

• Transforming E. coli cells with the recombinant plasmid

• Inducing protein expression under controlled conditions

• Cell lysis and membrane fraction isolation

• Solubilization of membrane proteins using appropriate detergents

• Purification via His-tag affinity chromatography

• Quality assessment by SDS-PAGE (purity >90% should be achieved)

What are the optimal storage and handling conditions for recombinant nuoK protein?

For optimal stability and activity of recombinant A. caulinodans nuoK protein, the following conditions are recommended:

• Storage: Store at -20°C/-80°C upon receipt

• Aliquoting: Essential for avoiding repeated freeze-thaw cycles

• Storage buffer: Tris/PBS-based buffer containing 6% trehalose, pH 8.0

• Reconstitution: Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Glycerol addition: Add 5-50% glycerol (final concentration) for long-term storage

• Working aliquots can be stored at 4°C for up to one week

It's important to note that repeated freezing and thawing should be avoided to maintain protein integrity and activity.

How can I design functional assays for NADH-quinone oxidoreductase activity?

Functional characterization of NADH-quinone oxidoreductase activity can be approached through several methodologies:

• Spectrophotometric assays: Monitor the reduction of quinones by following the decrease in NADH absorbance at 340 nm. This can be done using various quinone substrates to assess substrate specificity.

• Oxygen consumption measurements: Since NADH-quinone oxidoreductase activity can be linked to respiratory chain function, oxygen uptake rates can be measured using an oxygen electrode. In A. caulinodans, succinate-dependent oxygen uptake rates typically range from 178 to 236 nmol/min/mg of protein .

• Enzyme kinetics analysis: Determine kinetic parameters (Km, Vmax) for different substrates. For NADH-quinone oxidoreductases, high-precision kinetic parameters can be obtained by varying substrate concentrations and measuring initial reaction rates .

• Inhibitor studies: Use specific inhibitors of NADH-quinone oxidoreductase to characterize the enzyme's sensitivity and specificity.

When designing these assays, it's important to consider that NADH-quinone oxidoreductases and azoreductases belong to the same FMN-dependent superfamily of enzymes , and may have overlapping substrate specificities.

How does nuoK contribute to respiratory adaptation under varying oxygen conditions in A. caulinodans?

A. caulinodans exhibits remarkable adaptability to different oxygen concentrations, which is critical for both its free-living and symbiotic nitrogen-fixing capabilities. The nuoK subunit, as part of the NADH-quinone oxidoreductase complex, likely plays a significant role in this adaptation.

Research indicates that A. caulinodans can grow under varying oxygen conditions:

• Under ammonia-grown conditions, cells become oxygen-limited at 1.7 μM dissolved oxygen

• Nitrogen-fixing cells remain succinate-limited even at dissolved oxygen concentrations as low as 0.9 μM

• Nitrogen-fixing cells can tolerate dissolved oxygen concentrations as high as 41 μM

The respiratory chain components, including nuoK, must adapt to these changing conditions. In hypoxic environments necessary for nitrogen fixation, the expression and activity of respiratory complexes may be modulated to maintain energy production while protecting nitrogenase from oxygen damage.

Experimental approaches to investigate this include:

• Comparative proteomics of membrane fractions under different oxygen tensions

• Gene expression analysis of nuoK and other respiratory complex genes under varying oxygen levels

• Functional characterization of respiratory activity using oxygen consumption measurements and electron transfer rates

What is the role of nuoK in energy conservation during symbiotic nitrogen fixation?

During symbiotic nitrogen fixation in nodules, A. caulinodans must efficiently generate energy while maintaining appropriate oxygen levels for nitrogenase activity. The NADH-quinone oxidoreductase complex, including nuoK, likely contributes to this process in several ways:

• Energy generation: The complex couples NADH oxidation to proton translocation, contributing to ATP synthesis necessary for nitrogen fixation.

• Oxygen management: By participating in respiratory electron transport, the complex helps maintain low oxygen concentrations compatible with nitrogenase activity.

• Redox balance: The complex may help maintain appropriate NAD+/NADH ratios under the unique metabolic conditions of symbiotic nitrogen fixation.

Transcriptomic analyses have shown that numerous metabolic adaptations occur when A. caulinodans transitions from free-living to bacteroid states in stem nodules. Genes involved in sulfur uptake and metabolism, acetone metabolism, and exopolysaccharide biosynthesis are highly expressed in bacteroids compared to free-living cells . The expression and activity of respiratory chain components may also be regulated during this transition.

Research strategies to investigate nuoK's role in symbiotic nitrogen fixation could include:

• Comparative transcriptomics and proteomics of free-living versus bacteroid states

• Construction and characterization of nuoK mutants with altered expression or activity

• Analysis of energy metabolism in wild-type versus mutant strains during symbiosis

How does the structure of nuoK contribute to its function in the NADH-quinone oxidoreductase complex?

The nuoK protein from A. caulinodans is a small (102 amino acids) hydrophobic protein with multiple transmembrane domains . Structural analysis suggests it plays a role in forming the membrane domain of the NADH-quinone oxidoreductase complex, which is essential for proton translocation.

Key structural features include:

• Multiple transmembrane helices that anchor the protein in the membrane

• Hydrophobic residues that facilitate interactions with other membrane subunits

• Conserved residues that may participate in proton translocation or quinone binding

To investigate structure-function relationships, researchers could employ:

• Site-directed mutagenesis of conserved residues

• Protein-protein interaction studies to map interactions with other complex subunits

• Homology modeling based on resolved structures from related organisms

• Functional complementation studies with nuoK variants

How does A. caulinodans nuoK compare with homologous proteins in other bacteria?

A comparative analysis of nuoK proteins across different bacterial species can provide insights into conserved features and species-specific adaptations. The A. caulinodans nuoK protein shares structural and functional similarities with homologs in other bacteria, but may also possess unique characteristics related to the organism's nitrogen-fixing lifestyle.

A comparison with Helicobacter pylori nuoK (search result #15) shows:

• Both proteins are similar in size (A. caulinodans: 102aa, H. pylori: 100aa)

• Both can be expressed as recombinant proteins with N-terminal His tags in E. coli

• Both function as components of their respective NADH-quinone oxidoreductase complexes

• Amino acid sequence and conservation of functional residues

• Regulation of expression under different environmental conditions

• Interactions with other components of the respiratory chain

These differences may reflect adaptations to the different ecological niches and metabolic requirements of these organisms.

What insights can be gained from comparing nuoK expression in different physiological states of A. caulinodans?

A. caulinodans transitions between multiple physiological states:

• Free-living aerobic growth

• Free-living microaerobic nitrogen fixation

• Symbiotic nitrogen fixation in nodules

Comparing nuoK expression and function across these states can provide insights into respiratory adaptations that support nitrogen fixation. Transcriptomic analyses have shown that A. caulinodans undergoes substantial changes in gene expression when transitioning from free-living to bacteroid states .

For nuoK specifically, researchers could investigate:

• Changes in expression levels across different growth conditions

• Post-translational modifications that might regulate activity

• Protein-protein interactions that may differ between physiological states

• Functional consequences of these changes for energy metabolism and nitrogen fixation

Such comparative analyses could be performed using techniques such as:

• RNA-seq for transcriptional profiling

• Proteomics for protein expression and modification analysis

• Metabolomics to assess the impact on energy metabolism

• Functional assays to measure respiratory activity

How can mutational analysis be used to study nuoK function in A. caulinodans?

Mutational analysis is a powerful approach to investigate the function of nuoK in A. caulinodans. Based on methodologies described for other genes in A. caulinodans, such as actR, praR, and parA , the following strategy can be implemented:

• Construction of nuoK deletion mutant:

  • Amplify upstream and downstream fragments of nuoK from genomic DNA

  • Clone these fragments into a suicide vector (e.g., pCM351 or pK18mobsacB)

  • Introduce the construct into A. caulinodans via allelic exchange

  • Select mutants using appropriate antibiotics

  • Verify deletion by PCR

• Complementation studies:

  • Clone the entire open reading frame and predicted promoter of nuoK

  • Introduce into the deletion mutant using a broad-host-range vector (e.g., pBBR1MCS-2)

  • Create control strains with empty vectors

• Phenotypic characterization:

  • Growth analysis under different conditions (oxygen levels, nitrogen sources)

  • Respiratory activity measurements

  • Nitrogen fixation assays (acetylene reduction assay)

  • Symbiotic phenotype assessment (nodulation efficiency, nitrogen fixation in nodules)

This approach has been successfully used to characterize other genes in A. caulinodans, such as actR, which when deleted affected flagellar biosynthesis, biofilm formation, and symbiotic interactions .

How can protein-protein interaction studies be designed to investigate nuoK's role in respiratory complex assembly?

As a component of the NADH-quinone oxidoreductase complex, nuoK interacts with other subunits to form a functional enzyme. Investigating these interactions can provide insights into complex assembly and function. The following methodological approaches can be used:

• Co-immunoprecipitation (Co-IP):

  • Express epitope-tagged nuoK in A. caulinodans

  • Isolate membrane fractions

  • Perform immunoprecipitation using antibodies against the tag

  • Identify interacting proteins by mass spectrometry

• Bacterial two-hybrid system:

  • Create fusion constructs of nuoK and potential interacting partners

  • Introduce into a bacterial two-hybrid reporter strain

  • Screen for positive interactions based on reporter gene activation

• Cross-linking studies:

  • Treat intact cells or membrane preparations with cross-linking agents

  • Isolate nuoK-containing complexes

  • Identify cross-linked proteins by mass spectrometry

• Blue native PAGE:

  • Solubilize membrane complexes under native conditions

  • Separate complexes by blue native PAGE

  • Identify components by second-dimension SDS-PAGE and western blotting or mass spectrometry

These approaches can reveal how nuoK contributes to complex assembly and may identify unexpected interactions that provide new insights into respiratory chain organization in A. caulinodans.

What transcriptomic approaches can reveal about nuoK regulation in different physiological states?

Transcriptomic analysis can provide valuable insights into the regulation of nuoK expression under different conditions. Based on previous transcriptomic studies of A. caulinodans , the following approach can be implemented:

• Experimental design:

  • Grow A. caulinodans under multiple conditions:

    • Rich versus minimal media

    • Different nitrogen sources (ammonia, N₂)

    • Various oxygen tensions

    • Free-living versus bacteroid states

  • Extract RNA from each condition

  • Perform RNA-seq or microarray analysis

• Data analysis:

  • Identify differentially expressed genes across conditions

  • Focus on nuoK and other respiratory chain components

  • Perform cluster analysis to identify co-regulated genes

  • Map to metabolic pathways to understand physiological context

• Validation:

  • Confirm expression changes using RT-qPCR

  • Construct transcriptional fusions to reporter genes

  • Assess protein levels by western blotting

• Regulatory network analysis:

  • Identify potential regulatory elements in the nuoK promoter

  • Screen for transcription factors that bind to these elements

  • Construct regulatory network models

This approach has previously revealed that genes involved in sulfur metabolism, acetone metabolism, and exopolysaccharide biosynthesis are upregulated in bacteroids compared to free-living cells . Similar insights could be gained about nuoK regulation.