Recombinant Azorhizobium caulinodans Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To ensure a specific tag, please inform us during your order, and we will prioritize its development.
Synonyms
kdpC; AZC_1567; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)
Target Names
kdpC
Target Protein Sequence
MLSQIRPAITLLVAFTLLTGVAYPLAITGIGQTLFPSAANGSLVTRGGTVVGSLLIGQKT TGEGYFHPRPSAAGDAGYDAANSSGSNLAPTSQKLKARITADVAALREAGATGLIAADAV TTSGSGLDPHISPAFAYEQVERVAKARNLPETQVQTLVAGLVEGRDLGLFGEPRVNVLKL NLALDTLK
Uniprot No.

Target Background

Function

The KdpC subunit is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis, coupled with the electrogenic transport of potassium ions into the cytoplasm. Specifically, KdpC functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing KdpB subunit through the formation of a transient KdpB/KdpC/ATP ternary complex.

Database Links
Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the Azorhizobium caulinodans KdpC protein?

The KdpC protein in A. caulinodans is the C chain subunit of the potassium-transporting ATPase complex (KdpFABC). This 188-amino acid protein functions as part of the ATP phosphohydrolase [potassium-transporting] system . It serves as a potassium-binding and translocating subunit within this high-affinity K+ uptake system. The full amino acid sequence is:

MLSQIRPAITLLVAFTLLTGVAYPLAITGIGQTLFPSAANGSLVTRGGTVVGSLLIGQKTTGEGYFHPRPSAAGDAGYDAANSSGSNLAPTSQKLKARITADVAALREAGATGLIAADAVTTSGSGLDPHISPAFAYEQVERVAKARNLPETQVQTLVAGLVEGRDLGLFGEPRVNVLKLNLALDTLK

How is the KdpFABC system organized genetically in A. caulinodans?

The KdpFABC genes in A. caulinodans are organized in a specific genetic structure. The AZC_1565, AZC_1566, and AZC_1567 locus tags correspond to kdpA, kdpB, and kdpC respectively. These genes are adjacent in the genome. Additionally, a small open reading frame designated kdpF exists upstream of kdpA, though it doesn't have an assigned locus tag. Reverse transcription-PCR analysis has confirmed that the kdpFABC gene cluster is transcribed as a single operon .

What are the basic physical properties of recombinant KdpC protein?

The recombinant full-length KdpC protein from A. caulinodans has the following specifications:

ParameterSpecification
Protein LengthFull Length (1-188 amino acids)
SourceExpressed in E. coli
TagN-terminal His tag
FormLyophilized powder
Purity>90% as determined by SDS-PAGE
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Optimal Storage-20°C/-80°C, avoid repeated freeze-thaw cycles

For reconstitution, the protein should be diluted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol added for long-term storage .

How is the kdpFABC operon regulated in A. caulinodans?

The regulation of the kdpFABC operon in A. caulinodans involves a complex interplay between multiple potassium transport systems. Research findings demonstrate that:

  • Generally, transcription of the kdpFABC operon is positively controlled by the two-component system KdpDE in response to low K+ concentrations.

  • TrkJ appears to be involved in the repression of kdpFABC in response to high external K+ concentrations. In mutants with simultaneous deletions of kup, trkA and/or trkI, and trkJ, expression levels of kdpFABC remained high even under high-K+ conditions .

  • The Δkup ΔtrkJ mutant showed different expression patterns: kdpFABC was not induced under high-K+ conditions in free-living states but was highly expressed in stem nodules, suggesting environmental context-dependent regulation .

These findings indicate the presence of either inhibitors that interact with KdpDE or a regulatory system beyond KdpDE that controls kdpFABC expression. The specific interactions between TrkJ and the KdpDE two-component system warrant further investigation .

What is the relationship between KdpC function and symbiotic nitrogen fixation?

Research on A. caulinodans mutants reveals critical insights into the relationship between potassium transport systems and symbiotic nitrogen fixation:

  • Wild-type stem nodules express trkAI, trkJ, and kup, but not kdpFABC under normal conditions.

  • Interestingly, Δkup and Δkup ΔkdpA mutants formed Fix- nodules (unable to fix nitrogen), while the Δkup ΔtrkA ΔtrkI ΔtrkJ mutant formed Fix+ nodules (capable of nitrogen fixation) .

  • This counterintuitive result suggests that with the additional deletion of Trk system genes in the Δkup mutant, nitrogen-fixing capability was recovered.

  • In the Δkup ΔtrkJ mutant, kdpFABC was highly expressed in stem nodules but not in free-living states under high-K+ conditions.

These findings suggest that the TrkAI system is unable to function effectively in stem nodules, and the proper regulation of potassium transport systems, particularly the expression of kdpFABC, is crucial for efficient symbiotic nitrogen fixation .

How do cytoplasmic K+ levels vary among different A. caulinodans mutants?

Experimental data on various A. caulinodans mutants provide important insights into how different potassium transport systems affect cytoplasmic K+ levels:

  • The cytoplasmic K+ levels in the Δkup ΔtrkA ΔtrkI mutant, which did not express kdpFABC under high-K+ conditions, were markedly lower than those in the Δkup ΔtrkA ΔtrkI ΔtrkJ mutant .

  • The Δkup ΔtrkA ΔtrkI ΔtrkJ mutant highly expressed kdpFABC even under high-K+ conditions.

This differential expression pattern suggests that TrkJ plays a key role in sensing extracellular K+ concentrations and repressing kdpFABC expression under high-K+ conditions. The ability to maintain appropriate cytoplasmic K+ levels appears to be essential for proper symbiotic function .

How should researchers design experiments to study kdpC expression?

When designing experiments to study kdpC expression in A. caulinodans, researchers should consider:

  • Variable selection: Clearly define independent variables (e.g., K+ concentration) and dependent variables (e.g., kdpFABC expression level, cytoplasmic K+ concentration) .

  • Controls: Include appropriate wild-type and mutant strains to isolate the specific effects of kdpC.

  • Reporter systems: Consider using a kdpF-lacZ fusion construct to measure transcriptional activity under various conditions, as demonstrated in previous research .

  • Environmental conditions: Test expression under both free-living and symbiotic conditions, as the function of K+ transport systems appears to differ between these states.

  • K+ concentration gradient: Test multiple K+ concentrations to fully characterize the response curve, rather than simple "high" vs. "low" conditions.

A robust experimental design should systematically manipulate K+ concentrations while measuring both kdpFABC expression and functional outcomes like nodule formation and nitrogen fixation capability .

What methods are appropriate for measuring kdpFABC expression?

To effectively measure kdpFABC expression, researchers can employ several complementary approaches:

  • Transcriptional fusions: Using kdpF-lacZ fusion constructs allows quantitative measurement of β-galactosidase activity as a proxy for transcriptional activity. This approach has been successfully employed to demonstrate that kdpFABC expression varies significantly between different mutant backgrounds and environmental conditions .

  • RT-PCR: Reverse transcription-PCR can be used to confirm operon structure and measure relative expression levels of kdpFABC genes .

  • RNA-seq: For a more comprehensive analysis, RNA sequencing can provide genome-wide expression data, allowing researchers to identify potential regulatory interactions affecting kdpFABC expression.

  • Protein detection: Western blotting with antibodies against KdpC or His-tagged recombinant KdpC can verify protein expression levels.

These techniques should be selected based on the specific research questions and available resources.

What are the critical considerations for working with recombinant KdpC protein?

When working with recombinant KdpC protein, researchers should consider:

  • Storage and handling:

    • Store at -20°C/-80°C upon receipt

    • Aliquot to avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

  • Reconstitution:

    • Briefly centrifuge vials before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add 5-50% glycerol for long-term storage

  • Experimental conditions:

    • Consider the effects of pH, temperature, and ionic composition on protein stability

    • Ensure appropriate buffer conditions when studying protein interactions

  • Quality control:

    • Verify protein purity (>90% by SDS-PAGE)

    • Confirm protein activity through functional assays

These considerations will help ensure reliable and reproducible results when working with recombinant KdpC protein.

How should researchers interpret contradictory results in different mutant backgrounds?

When faced with contradictory results across different A. caulinodans mutant backgrounds, researchers should:

  • Consider compensatory mechanisms: The unexpected finding that Δkup and Δkup ΔkdpA mutants formed Fix- nodules while the Δkup ΔtrkA ΔtrkI ΔtrkJ mutant formed Fix+ nodules suggests complex compensatory interactions between potassium transport systems .

  • Analyze context-specific regulation: The observation that kdpFABC expression in the Δkup ΔtrkJ mutant differs between free-living and symbiotic states highlights the importance of environmental context .

  • Examine cytoplasmic K+ levels: Measurements of actual K+ concentrations provide critical data for interpreting the functional consequences of mutations in transport systems.

  • Consider multiple regulatory pathways: The data suggest that TrkJ may represent a previously unrecognized regulatory pathway for kdpFABC expression, emphasizing the need to look beyond established models .

  • Evaluate experimental design: When results appear contradictory, carefully review experimental conditions, controls, and potential confounding variables .

What are the implications of TrkJ's role in K+ sensing?

The research suggests several important implications regarding TrkJ's role in K+ sensing:

  • Novel regulatory pathway: The findings propose that the transmembrane TrkJ protein acts as a sensor for extracellular K+ concentration and that high extracellular K+ concentrations repress the expression of KdpFABC via TrkJ .

  • Alternate sensing mechanisms: This represents a departure from the traditional view that KdpDE is the sole regulatory system for the kdpFABC operon.

  • Research directions: Further investigations should focus on:

    • Elucidating the structure of TrkJ

    • Determining whether TrkJ is a separate regulatory system or a protein inhibitor interfering with the KdpDE system

    • Investigating possible interactions between TrkJ and KdpD or KdpE

  • Evolutionary considerations: Researchers should examine whether similar regulatory mechanisms exist in other bacterial species, which could represent a conserved strategy for potassium homeostasis.

How can understanding KdpC function advance agricultural applications?

The study of KdpC and potassium transport systems in A. caulinodans has significant implications for agricultural applications:

  • Enhanced symbiotic nitrogen fixation: A deeper understanding of how potassium transport affects nodule formation and nitrogen fixation could lead to strategies for enhancing biological nitrogen fixation in legume crops.

  • Stress tolerance: Potassium is crucial for plant stress responses. Understanding bacterial potassium transport in the context of plant-microbe interactions could help develop more resilient agricultural systems.

  • Biofertilizer development: Knowledge of the molecular mechanisms underlying successful symbiotic relationships could inform the development of more effective biofertilizers.

  • Host range expansion: Insights into the factors determining successful symbiosis might help expand the host range of nitrogen-fixing bacteria to non-legume crops.

What are the promising future research directions for KdpC studies?

Several promising research directions emerge from current knowledge about KdpC:

  • Structural studies: Determining the three-dimensional structure of KdpC and how it interacts with other components of the KdpFABC complex.

  • Regulatory networks: Further elucidation of the complex regulatory networks controlling kdpFABC expression, particularly the role of TrkJ and its potential interactions with KdpDE.

  • Comparative genomics: Analyzing KdpC sequences and functions across diverse bacterial species to understand evolutionary conservation and specialization.

  • Systems biology approaches: Integrating data on K+ transport, gene expression, protein interactions, and symbiotic outcomes to develop comprehensive models of bacterial potassium homeostasis.

  • Application-oriented research: Developing strategies to manipulate KdpC and related systems to enhance nitrogen fixation efficiency in agricultural settings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.