Recombinant Azorhizobium caulinodans Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Biological Role in Azorhizobium caulinodans

HtpX homologs are integral to stress response pathways, particularly in degrading misfolded membrane proteins under environmental stress. In A. caulinodans, HtpX operates within a network of chaperones and proteases (e.g., ClpB, DnaK) to maintain cellular homeostasis . Key functions include:

  • Membrane Protein Quality Control: Degrades damaged or misfolded membrane proteins via ATP-independent proteolysis .

  • Interaction with Stress Systems: Linked to the Cpx two-component system in related bacteria, which monitors envelope stress .

Comparative Analysis with Homologs

HtpX shares functional similarities with proteases in other species, such as Geobacter uraniireducens (UniProt A5GAQ7) . Conserved residues (e.g., GGMMVA) and catalytic motifs suggest evolutionary preservation of its role in membrane protein turnover . Unlike soluble chemotaxis proteins like CheZ in A. caulinodans, HtpX operates at the membrane-cytosol interface .

Outstanding Research Questions

Current gaps in knowledge include:

  • Regulatory Mechanisms: How hypoxia or nitrogen fixation modulates HtpX activity.

  • Substrate Range: Specific proteins targeted by HtpX in A. caulinodans.

  • Symbiotic Relevance: Potential role in nodulation or host interaction, akin to chemotaxis proteins (e.g., TlpA1) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchase method or location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
htpX; AZC_4701; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-312
Protein Length
full length protein
Species
Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)
Target Names
htpX
Target Protein Sequence
MNYMRTAVLLAGLTALFMVVGFAIGGKGGMMVALLVAAGMNLFSYWYADKIVLGMYGARE VDMRTAPEFVAMVAELARRAELPMPKVYIIDNPQPNAFATGRNPQNAAVAATTGLLQTLN PDEVAGVMAHELAHVKHHDTLTMTITASIAGAISMLANFGLFFGGGNRESNNPFGGISAI LMAILAPIAAMVVQMAISRSREYEADRGGAEICGQPLALASALAKIAGGAHAVPNYAAEA NPATAHMFIINPLSGARMDNLFSTHPNTENRIAALEDLARQMGGYRPAPARAAPARGPWG GNTGGTRRGPWG
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing recombinant A. caulinodans HtpX?

The most effective expression system documented for recombinant proteases from this family is E. coli. Based on successful expression protocols with related proteases, the following approach is recommended:

  • Construct design: Clone the full-length htpX gene (including its native promoter) from A. caulinodans ORS571 genomic DNA using polymerase chain reaction (PCR) .

  • Expression vector selection: A broad-host-range plasmid like pBBR1MCS-2 can be effective for expressing A. caulinodans proteins .

  • Tag selection: N-terminal His-tagging has proven effective for related proteases, facilitating purification while maintaining functionality .

  • Host strain: Standard E. coli expression strains (BL21(DE3) or derivatives) typically yield good results for bacterial proteases .

  • Expression conditions: For optimal expression, induction at OD600 of 0.6-0.8 with appropriate inducer concentration, followed by growth at lower temperatures (16-25°C) can help ensure proper folding of membrane proteases.

The expression protocol should be optimized specifically for A. caulinodans HtpX, with particular attention to maintaining the native conformation of this potentially membrane-associated protein.

What purification strategies yield the highest purity and activity for recombinant A. caulinodans HtpX?

For optimal purification of His-tagged A. caulinodans HtpX, a multi-step approach is recommended:

  • Cell lysis: Gentle lysis methods using mild detergents (0.5-1% Triton X-100 or n-dodecyl β-D-maltoside) are preferable to preserve the native conformation of membrane-associated proteases.

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin with imidazole gradient elution (50-250 mM) effectively captures His-tagged proteins .

  • Secondary purification: Size exclusion chromatography to separate aggregates and remove remaining contaminants.

  • Buffer optimization:

    Buffer ComponentConcentrationPurpose
    Tris/PBS20-50 mMMaintains physiological pH
    NaCl150-300 mMPrevents non-specific interactions
    Glycerol5-10%Enhances stability
    Reducing agent (DTT/BME)1-5 mMPrevents oxidation
    Protease inhibitorsAs recommendedPrevents degradation
  • Storage considerations: For long-term storage, lyophilization or addition of 50% glycerol and storage at -20°C/-80°C is recommended to maintain stability . Avoid repeated freeze-thaw cycles which can drastically reduce activity.

Validation of purity should be performed using SDS-PAGE, with >90% purity considered adequate for most research applications .

How does A. caulinodans HtpX function within the broader proteolytic network during symbiotic nitrogen fixation?

The role of HtpX within A. caulinodans' proteolytic network during symbiotic nitrogen fixation must be considered in the context of other proteases like Lon, which has been extensively studied in this organism.

Research on Lon protease in A. caulinodans has demonstrated its critical role in symbiotic nitrogen fixation. While the nitrogen fixation activity of A. caulinodans lon mutant in free-living conditions was not significantly different from wild-type, stem nodules formed by the lon mutant showed little or no nitrogen fixation activity . This suggests a complex interplay between proteases during symbiosis.

The potential functional network of A. caulinodans proteases likely includes:

  • Lon protease: Regulates expression of reb genes, which affect symbiotic nitrogen fixation .

  • HtpX: Potentially involved in quality control of membrane proteins during adaptation to symbiotic conditions.

  • ClpX: Located in genomic proximity to lon in A. caulinodans (AZC_1609 adjacent to lon AZC_1610), suggesting possible functional relationships .

To investigate HtpX's role in this network, researchers should consider:

  • Creating htpX deletion mutants and double mutants (htpX/lon) to assess symbiotic phenotypes

  • Examining transcriptional regulation of htpX during different stages of symbiosis

  • Identifying HtpX substrates using proteomics approaches

  • Analyzing protein localization patterns during free-living versus symbiotic growth conditions

The aberrations observed in stem nodules formed by lon mutants provide a framework for investigating whether HtpX might have complementary or opposing functions in maintaining symbiotic homeostasis.

What methodologies are most effective for identifying the physiological substrates of A. caulinodans HtpX?

Identifying the physiological substrates of A. caulinodans HtpX requires a multi-faceted approach combining genetics, proteomics, and biochemical validation:

  • Comparative proteomics approach:

    • Compare protein profiles of wild-type and htpX deletion mutants using quantitative proteomics

    • Focus analysis on membrane fraction and periplasmic space proteins

    • Perform analysis under both standard and stress conditions (heat, oxidative stress)

    ConditionSample TypesAnalysis MethodExpected Outcome
    Standard growthWT vs ΔhtpXLC-MS/MSIdentification of constitutive substrates
    Heat stress (42°C)WT vs ΔhtpXLC-MS/MSStress-specific substrates
    Symbiotic conditionsBacteroids from nodulesLC-MS/MSSymbiosis-related substrates
  • Substrate trapping mutants:

    • Engineer catalytically inactive HtpX variants (by mutating the putative active site residues)

    • Perform pull-down experiments to identify trapped substrates

    • Validate using in vitro degradation assays with purified components

  • In vivo proximity labeling:

    • Fuse HtpX to proximity labeling enzymes (BioID or APEX2)

    • Identify proteins in close proximity to HtpX in living cells

    • Cross-validate with proteomics data

This approach parallels methodology used in studying protein-protein interactions in A. caulinodans, where fluorescently labeled proteins have been successfully employed to study protein localization and interactions .

How does the cellular localization of HtpX in A. caulinodans compare to localization patterns of other proteases, and what methods best visualize this distribution?

The cellular localization of HtpX in A. caulinodans can be studied using approaches similar to those employed for investigating CheZ localization in this organism. Based on the literature, we can provide methodological recommendations:

  • Fluorescent protein fusion approach:

    • Generate HtpX-GFP (or other fluorescent protein) fusion constructs under native promoter control

    • Introduce these constructs into both wild-type and htpX mutant backgrounds

    • Validate functionality of fusion proteins by complementation assays

  • Microscopy techniques for visualization:

    • Super-resolution microscopy for precise subcellular localization

    • Time-lapse fluorescence microscopy to capture dynamic localization patterns

    • Co-localization studies with membrane markers and other proteases

  • Control experiments to determine localization dependencies:

    • Examine HtpX localization in various mutant backgrounds (e.g., lon mutant)

    • Test HtpX localization under different growth conditions and stresses

    • Create truncated variants to identify domains responsible for localization

Research on CheZ localization in A. caulinodans demonstrated that fusion proteins expressed from their native promoters provided reliable localization data. CheZ was found to localize to cell poles independently of CheA, with specific motifs (AXXFQ) being crucial for proper localization . This methodological approach provides a solid foundation for HtpX localization studies.

Comparing HtpX localization with that of Lon protease would be particularly informative given Lon's established role in symbiotic nitrogen fixation .

What experimental controls and validations are essential when studying enzymatic activity of recombinant A. caulinodans HtpX?

Rigorous controls and validations are essential for reliable characterization of A. caulinodans HtpX enzymatic activity:

  • Essential controls for activity assays:

    • Negative controls: Heat-inactivated HtpX; catalytically inactive mutants (active site mutants)

    • Positive controls: Well-characterized proteases with similar substrate specificities

    • Buffer controls: Assess effects of different buffer compositions, pH ranges, and ion concentrations

  • Validation of substrate specificity:

    • Use multiple substrate types (fluorogenic peptides, full-length proteins)

    • Perform competition assays with known and putative substrates

    • Validate cleavage sites using mass spectrometry

  • Verification of recombinant protein quality:

    • Circular dichroism to confirm proper folding

    • Size-exclusion chromatography to verify monomeric state or proper oligomerization

    • Thermal shift assays to assess stability

  • Statistical considerations:

    • Perform assays with at least three biological replicates and technical triplicates

    • Apply appropriate statistical tests (ANOVA, t-tests) with corrections for multiple comparisons

    • Report enzyme kinetic parameters (Km, Vmax, kcat) with standard errors

  • In vivo validation:

    • Complementation of htpX mutant phenotypes with wild-type and enzymatically inactive HtpX variants

    • Assessment of substrate levels in vivo compared to in vitro degradation results

These validation approaches are consistent with rigorous practices in enzyme characterization and will ensure reliable and reproducible assessment of HtpX activity.

What strategies can resolve contradictions between in vitro activity data and in vivo phenotypic observations for A. caulinodans HtpX?

Resolving contradictions between in vitro and in vivo observations requires systematic investigation of potential sources of discrepancy:

  • Examination of experimental conditions:

    • In vitro conditions may not reflect physiological environment:

      ParameterIn vitro conditionPhysiological conditionAdjustment strategy
      pHOften standardized (pH 7.4)May vary by compartmentTest activity across pH range 5.5-8.0
      IonsSimplified buffer systemsComplex ion compositionInclude physiologically relevant ions
      Redox stateOften reducingVariable by compartmentTest activity under different redox conditions
    • Substrate accessibility: In vivo compartmentalization may restrict enzyme-substrate interactions

    • Post-translational modifications: Purified protein may lack critical modifications

  • Investigation of potential cofactors or binding partners:

    • Perform pull-down experiments to identify interacting proteins

    • Test activity in the presence of cell extracts or identified binding partners

    • Examine effects of small molecule cofactors or inhibitors

  • Methodological approach to reconciliation:

    • Develop assay conditions that better mimic in vivo environment

    • Create in vitro reconstitution systems with membrane components if HtpX is membrane-associated

    • Use conditional expression systems to correlate protein levels with phenotypic effects

  • Advanced approaches:

    • Single-cell studies to capture cell-to-cell heterogeneity in protein activity

    • Microfluidic approaches to rapidly test multiple conditions

    • Computational modeling to predict activity under various conditions

This approach parallels methods used in resolving similar contradictions in high-throughput screening data, where secondary analysis and validation steps are critical for accurate interpretation .

How should researchers design experiments to investigate potential roles of A. caulinodans HtpX in plant-microbe interactions and symbiotic nitrogen fixation?

Designing experiments to investigate A. caulinodans HtpX's role in plant-microbe interactions requires a comprehensive approach spanning molecular, cellular, and organismal levels:

  • Genetic manipulation strategies:

    • Generate clean deletion mutants of htpX

    • Create complemented strains with wild-type and catalytically inactive variants

    • Develop conditional expression systems to regulate HtpX levels during symbiosis

  • In planta experimental design:

    • Compare nodulation efficiency between wild-type and htpX mutants

    • Assess nitrogen fixation activity using acetylene reduction assays

    • Examine bacteroid differentiation and persistence within nodules using microscopy

  • Molecular phenotyping:

    • Transcriptome analysis of both bacterial and plant genes during infection process

    • Proteome analysis focusing on membrane and secreted proteins

    • Metabolomic analysis to detect changes in nitrogen metabolism

  • Microscopy approaches:

    • Track bacterial colonization using fluorescently labeled strains

    • Perform electron microscopy to examine ultrastructural features of bacteroids

    • Use live-cell imaging to monitor infection dynamics

  • Experimental parameters to monitor:

    ParameterMeasurement methodExpected insights
    Nodule numberVisual countingInfection success
    Nodule morphologyLight/electron microscopySymbiotic development
    Nitrogenase activityAcetylene reduction assayFunctional nitrogen fixation
    Plant growth parametersBiomass, N contentSymbiotic effectiveness
    Bacterial persistenceCFU counts from nodulesBacteroid stability

This approach builds on established methodologies used to study other A. caulinodans proteins in symbiosis, such as Lon protease, which has been shown to affect nodule formation and function through regulation of gene expression . The observation of phenotypic differences between free-living and symbiotic states for lon mutants suggests that similar differential effects might exist for htpX mutants.

What are the optimal conditions for measuring HtpX protease activity in membrane fractions versus with purified recombinant protein?

Measuring HtpX protease activity requires different approaches depending on whether working with membrane fractions or purified protein:

For membrane fraction assays:

  • Membrane preparation:

    • Harvest cells in log phase

    • Disrupt cells by French press or sonication in buffer containing 50 mM Tris-HCl (pH 7.5), 250 mM sucrose, 1 mM EDTA

    • Remove unbroken cells by low-speed centrifugation (5,000 × g, 10 min)

    • Collect membranes by ultracentrifugation (100,000 × g, 1 hour)

    • Wash membranes to remove peripheral proteins

  • Activity assay conditions:

    • Buffer: 50 mM HEPES (pH 7.0-8.0), 100 mM NaCl, 5 mM MgCl₂

    • Temperature range: 25-37°C

    • Include detergent (0.05-0.1% DDM or Triton X-100) to maintain membrane protein solubility

    • Monitor activity using fluorogenic peptide substrates or specific protein substrates

For purified recombinant protein:

  • Protein reconstitution:

    • If membrane-associated, reconstitute in proteoliposomes or nanodiscs

    • For soluble domains, ensure proper folding verified by circular dichroism

  • Optimized assay conditions:

    • Buffer: 20 mM Tris-HCl (pH 7.5), 150 mM NaCl, 5 mM MgCl₂

    • Include 10% glycerol for protein stability

    • Test activity with and without reducing agents (1-5 mM DTT)

    • Monitor kinetics at different substrate concentrations to determine Km and Vmax

  • Activity detection methods:

    • FRET-based peptide substrates for continuous monitoring

    • SDS-PAGE and western blotting for protein substrate cleavage

    • Mass spectrometry to identify cleavage sites

When comparing activities between membrane fractions and purified protein, researchers should normalize activity to protein amount and consider that membrane environment may provide essential cofactors or structural elements required for full activity.

How can researchers distinguish between the direct effects of HtpX protease activity and indirect effects caused by regulatory cascades in A. caulinodans?

Distinguishing direct from indirect effects of HtpX protease activity requires a multi-faceted experimental strategy:

  • Direct biochemical validation:

    • Demonstrate in vitro cleavage of putative substrates using purified components

    • Map cleavage sites using mass spectrometry and verify these sites in vivo

    • Use unbiased proteomics to identify proteins that accumulate in htpX mutants

  • Genetic strategies:

    • Create catalytically inactive HtpX variants (point mutations in the active site)

    • Compare phenotypes between deletion mutants and catalytically inactive mutants

    • Use suppressor screens to identify genetic interactions

  • Temporal analysis:

    • Use inducible expression systems to trigger HtpX expression and monitor immediate effects

    • Perform time-course experiments to distinguish primary (rapid) from secondary (delayed) effects

    • Employ pulse-chase experiments to track substrate degradation kinetics

  • Systems biology approach:

    • Integrate transcriptomics, proteomics, and metabolomics data

    • Build network models to predict direct versus indirect effects

    • Validate model predictions experimentally

Lessons from studies on Lon protease in A. caulinodans provide valuable insights, as Lon was found to regulate expression of reb genes, affecting symbiotic nitrogen fixation indirectly . Similar indirect regulatory effects might exist for HtpX and should be distinguished from its direct proteolytic functions.

What quality control measures should be implemented when analyzing HtpX activity data across different experimental batches?

Implementing robust quality control for HtpX activity data requires addressing common sources of variation in high-throughput and enzymatic assays:

  • Standardization of protein preparation:

    • Use consistent expression and purification protocols

    • Verify protein quality by SDS-PAGE, western blotting, and activity assays

    • Prepare large batches of protein and store identical aliquots to minimize variation

  • Assay standardization and normalization:

    • Include internal standards in each experiment

    • Normalize data to positive controls run in parallel

    • Use the same lot of substrates when possible

  • Experimental design considerations:

    • Include technical replicates (minimum triplicate)

    • Randomize sample positions to account for positional effects

    • Include inter-plate and inter-day controls to assess variability

  • Statistical approaches to control batch effects:

    • Use mixed-effects models to account for batch variation

    • Apply batch correction algorithms when combining data from multiple experiments

    • Perform power analysis to determine appropriate sample sizes

  • Documentation practices:

    • Record detailed metadata for each experiment (date, operator, reagent lots)

    • Document all normalization steps and data transformations

    • Maintain raw data alongside processed results

These quality control measures parallel recommendations for high-throughput screening data analysis, where batch effects, plate position effects, and run-date variation can significantly impact results . Implementing these controls will enhance reproducibility and reliability of HtpX activity measurements across different experimental conditions.

What emerging technologies could advance understanding of A. caulinodans HtpX structure-function relationships?

Several cutting-edge technologies hold promise for deeper insights into A. caulinodans HtpX structure-function relationships:

  • Structural biology approaches:

    • Cryo-electron microscopy: For determining high-resolution structures of membrane-embedded HtpX

    • Hydrogen-deuterium exchange mass spectrometry: To map dynamic regions and conformational changes

    • Crosslinking mass spectrometry: To identify interaction interfaces with substrates and binding partners

    • AlphaFold2 and related AI tools: For predicting structural features and substrate interactions

  • Advanced microscopy techniques:

    • Super-resolution microscopy: To visualize HtpX localization at nanometer resolution

    • Single-molecule FRET: To monitor conformational dynamics during substrate processing

    • Live-cell single-molecule tracking: To observe HtpX behavior in living bacterial cells

  • Genetic technologies:

    • CRISPR interference: For precise temporal control of htpX expression

    • Proximity labeling: To identify the HtpX interactome in different cellular contexts

    • Deep mutational scanning: To comprehensively map structure-function relationships

  • Systems biology integration:

    • Multi-omics data integration: To place HtpX in broader cellular networks

    • Machine learning approaches: To predict substrate specificity from primary sequence

    • Computational modeling: To simulate effects of HtpX activity on cellular homeostasis

These technologies could help resolve critical questions about HtpX, such as substrate specificity determinants, regulatory mechanisms, and its role within bacterial proteostasis networks during symbiotic relationships.

How might comparative studies across different rhizobial species inform the evolution and specialization of HtpX proteases in symbiotic bacteria?

Comparative studies across rhizobial species can provide valuable insights into HtpX evolution and specialization:

  • Phylogenetic analysis approaches:

    • Construct phylogenetic trees of HtpX sequences from diverse rhizobial species

    • Identify conserved domains versus variable regions that might confer species-specific functions

    • Correlate sequence variations with symbiotic host range and environmental niches

  • Functional complementation experiments:

    • Express HtpX homologs from different species in A. caulinodans htpX mutants

    • Assess restoration of phenotypes related to growth, stress resistance, and symbiosis

    • Identify critical residues through targeted mutagenesis of divergent regions

  • Comparative genomic context analysis:

    • Examine genomic neighborhoods of htpX genes across species

    • Identify co-evolved gene clusters that might indicate functional relationships

    • Compare regulatory elements to understand differential expression patterns

  • Cross-species substrate conservation:

    • Determine whether substrate specificity is conserved across different rhizobial HtpX proteases

    • Identify core versus species-specific substrates

    • Correlate substrate differences with symbiotic lifestyle adaptations

This comparative approach would build upon insights from research on other A. caulinodans proteins like CheZ, where novel motifs affecting protein localization were identified that are conserved across proteobacteria , suggesting evolutionary conservation of functional elements.

What methodological innovations could overcome current limitations in studying membrane-associated proteases like HtpX in symbiotic systems?

Current limitations in studying membrane-associated proteases in symbiotic systems could be addressed through several methodological innovations:

  • In situ approaches for studying bacteroids:

    • Multi-modal imaging: Combining fluorescence with electron microscopy

    • Expansion microscopy: For improved resolution within nodule tissues

    • Label-free imaging techniques: For studying native, unmodified proteins

  • Advances in protein engineering:

    • Split-fluorescent protein systems: To study protein-protein interactions in intact nodules

    • Activity-based probes: For monitoring protease activity within bacteroids

    • Optogenetic tools: For temporal control of protease activity during symbiosis

  • Technological innovations for bacteroid isolation and analysis:

    • Microfluidic approaches: For gentle isolation of viable bacteroids

    • Single-bacteroid transcriptomics/proteomics: To capture cell-to-cell heterogeneity

    • In situ proteomics: For spatial mapping of protein abundance within nodules

  • Systems for reconstituting symbiotic conditions:

    • Organoid-like systems: To recreate plant-microbe interfaces in controlled conditions

    • Microfluidic plant-on-a-chip: To visualize early infection events

    • Defined co-culture systems: To study specific aspects of symbiotic interactions

These innovations would help overcome challenges similar to those faced when studying Lon protease in A. caulinodans, where the protease showed different behaviors in free-living versus symbiotic conditions . New methodologies could provide insight into why certain proteases become particularly important during symbiosis despite having minor roles during free-living growth.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.