Recombinant Azotobacter vinelandii Apolipoprotein N-acyltransferase (lnt)

Shipped with Ice Packs
In Stock

Description

Enzymatic Function and Biological Role

Apolipoprotein N-acyltransferase (Lnt) is a membrane-bound enzyme that transfers an acyl group from phosphatidylethanolamine to the α-amino group of the N-terminal cysteine residue of bacterial lipoproteins. This reaction converts diacylated prolipoproteins into triacylated mature forms, essential for their stability and integration into the outer membrane . In Azotobacter vinelandii, Lnt is encoded by the lnt gene (locus Avin_09030) and shares functional homology with Lnt enzymes in other Gram-negative bacteria like Escherichia coli .

Recombinant Production and Purification

The recombinant A. vinelandii Lnt is expressed in E. coli and purified under the following conditions :

ParameterDetail
Expression HostEscherichia coli
TagUndetermined (varies by production batch)
Storage BufferTris-based buffer with 50% glycerol
Storage Temperature-20°C (short-term), -80°C (long-term)
Purity>85% (SDS-PAGE verified)
Sequence CoverageFull-length (residues 1–516)

Biochemical Properties

  • Activity: The enzyme catalyzes N-acylation via a two-step ping-pong mechanism, forming a thioester intermediate with the acyl donor before transferring it to the apolipoprotein .

  • Substrate Specificity: Prefers phosphatidylethlycerol as the acyl donor, with a conserved affinity for the N-terminal cysteine of lipoproteins .

  • Stability: Repeated freeze-thaw cycles are not recommended; working aliquots can be stored at 4°C for up to one week .

Research Applications

Recombinant A. vinelandii Lnt is primarily used to study:

  • Lipoprotein maturation: Mechanistic insights into Gram-negative bacterial envelope biogenesis .

  • Antimicrobial targeting: Lnt is essential for bacterial viability, making it a potential target for novel antibiotics .

  • Structural biology: Conformational dynamics and substrate interactions resolved via crystallography .

Comparative Analysis with Homologs

While A. vinelandii Lnt shares functional homology with E. coli Lnt, key distinctions include:

  • Fatty acid specificity: A. vinelandii lipoproteins may incorporate unique acyl chains (e.g., tuberculostearic acid in mycobacteria), though direct evidence for this species is pending .

  • Genetic context: The lnt gene in A. vinelandii (Avin_09030) is distinct from nitrogenase-related genes (e.g., nif, vnf), which dominate this organism’s research focus .

Unresolved Questions and Future Directions

  • Does A. vinelandii Lnt interact with other lipid-modifying enzymes (e.g., Lgt, LspA) in a conserved pathway?

  • How do structural variations in A. vinelandii Lnt affect substrate recognition compared to E. coli or mycobacterial homologs?

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
lnt; Avin_09030; Apolipoprotein N-acyltransferase; ALP N-acyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-516
Protein Length
full length protein
Species
Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Target Names
lnt
Target Protein Sequence
MRWITRPGWPGNLLALAAGALMPLAQAPFDLWPLALLSLALLYLGLREAPPRAALWRGWC YGFGLYAVGTSWIYISIHDYGAASLPLAGLLTLALMLALAFFFALPAWLWSRWLRRSDAP LADALAFAALWLALEGFRGWFLTGFPWLYAGYSQLEGPLAGLAPLGGVWLLSFALALSAA LLVNLPRLLRRPPALLGALVLLLAPWATGLALRGHAWTAPAGAPLKVAAVQGNVEQNLKW DPEQLSAQLLLYRDLTLQRAAPVDLVVWPETAVPILKEYAENYLAGLDRYARPRHMALLT GVPIRRHNAQGEPRYYNGIVVAGEGSGTYLKQKLVPFGEYVPLQEVLRGLIAFFDLPMSD FARGPADQPLLEARGWRIAPYICYEVVYPEFAAGLAARSDLLLTISNDAWFGSSIGPLQH LQMAQMRALEAGRWMIRTTNNGVTALIDPFGRITERLPQFQRAVLYGEVTPMQGLTPYLR WRAWPLAGLAVLLLGWALLRRRAERAAPGPAVEAQR
Uniprot No.

Target Background

Function
This enzyme catalyzes the phospholipid-dependent N-acylation of the N-terminal cysteine of apolipoprotein, representing the final step in lipoprotein maturation.
Database Links
Protein Families
CN hydrolase family, Apolipoprotein N-acyltransferase subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Apolipoprotein N-acyltransferase (Lnt) and what is its function in Azotobacter vinelandii?

Apolipoprotein N-acyltransferase (Lnt) in Azotobacter vinelandii is an essential integral membrane enzyme responsible for the final step in bacterial lipoprotein maturation. It catalyzes the N-acylation of the terminal cysteine residue of apolipoproteins, forming mature lipoproteins that are crucial components of the bacterial cell envelope . This post-translational modification process is unique to Gram-negative bacteria, making it an important area of study for understanding bacterial physiology and potential antimicrobial targets.

The enzyme has the EC designation 2.3.1.- and functions within the bacterial inner membrane where it transfers an acyl chain from membrane phospholipids to the α-amino group of the conserved cysteine residue at the N-terminus of lipoproteins . This N-acylation completes a three-step sequential process of lipoprotein maturation, resulting in a triacylated lipoprotein that can properly function in the cell envelope.

What is the structural composition of Azotobacter vinelandii Lnt?

The Azotobacter vinelandii Lnt protein consists of 516 amino acids as indicated by its full protein sequence . Based on its amino acid sequence, the protein is predicted to contain multiple transmembrane domains, consistent with its function as an integral membrane enzyme. The protein sequence reveals a high content of hydrophobic amino acids, particularly in segments that likely form transmembrane helices.

The enzyme contains regions responsible for substrate binding and catalysis, though detailed structural information from the provided sources is limited. Research indicates that Lnt undergoes conformational changes during catalysis, which are important for its enzymatic function . The structure likely includes a periplasmic catalytic domain containing the active site where the N-acylation reaction occurs.

How does Azotobacter vinelandii Lnt differ from Lnt in other bacterial species?

The Azotobacter vinelandii Lnt (UniProt accession C1DMW2) likely shares conserved catalytic residues with other bacterial Lnt proteins while having species-specific variations in non-catalytic regions . These variations may affect substrate specificity, enzyme stability, or regulatory mechanisms. Comparative sequence analysis would be necessary to identify specific differences between Azotobacter vinelandii Lnt and its homologs in other species.

What are the optimal conditions for expressing and purifying recombinant Azotobacter vinelandii Lnt?

Expression and purification of recombinant Azotobacter vinelandii Lnt present significant challenges due to its nature as an integral membrane protein. Based on general protocols for similar proteins, researchers should consider the following methodological approach:

  • Expression system selection: E. coli BL21(DE3) or C43(DE3) strains are often suitable for membrane protein expression. Consider using vectors with tunable promoters to control expression levels and avoid toxicity.

  • Growth conditions: Cultivation at lower temperatures (16-20°C) after induction can improve protein folding. Supplementation with specific phospholipids may enhance proper folding and stability.

  • Membrane extraction: Use gentle detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) for membrane solubilization.

  • Purification strategy:

    • Initial purification using affinity chromatography (if tagged, as mentioned in the product description that "tag type will be determined during production process" )

    • Further purification via size exclusion chromatography

    • Storage in Tris-based buffer with 50% glycerol as indicated for the commercial preparation

  • Stability considerations: Storage at -20°C or -80°C for extended periods, with working aliquots kept at 4°C for up to one week to avoid repeated freeze-thaw cycles .

How can researchers effectively assay the enzymatic activity of recombinant Azotobacter vinelandii Lnt?

Assessing the enzymatic activity of recombinant Azotobacter vinelandii Lnt requires specialized assays that monitor the N-acylation of lipoprotein substrates. Researchers should consider the following methodological approaches:

  • In vitro assay using synthetic substrates:

    • Prepare synthetic lipopeptide substrates mimicking the diacylated lipoprotein intermediate

    • Use radiolabeled or fluorescently labeled lipid donors

    • Monitor product formation by thin-layer chromatography (TLC), HPLC, or mass spectrometry

  • Reconstitution in proteoliposomes:

    • Incorporate purified Lnt into liposomes of defined composition

    • Add appropriate substrate and phospholipid donors

    • Assess activity by measuring the conversion of diacylated to triacylated lipoprotein

  • Complementation assays:

    • Use an E. coli lnt conditional mutant strain

    • Express A. vinelandii Lnt and assess its ability to restore growth under non-permissive conditions

    • Analyze lipoprotein processing by gel mobility shift assays or mass spectrometry

  • Spectroscopic monitoring:

    • Design FRET-based assays that detect conformational changes during catalysis

    • Use intrinsic tryptophan fluorescence to monitor structural changes upon substrate binding

Each approach has advantages and limitations, and researchers may need to combine multiple methods to comprehensively characterize enzymatic activity.

What techniques are most effective for studying the conformational changes in Azotobacter vinelandii Lnt during catalysis?

Based on the limited information from search result , conformational changes in Lnt are important aspects of its function. Researchers investigating these changes should consider the following methodological approaches:

  • X-ray crystallography:

    • Crystallize the enzyme in different states (apo, substrate-bound, product-bound)

    • Compare structures to identify conformational differences

    • This has been successful as mentioned in search result , where two crystal forms have been reported

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Monitor solvent accessibility changes in different functional states

    • Identify regions undergoing conformational rearrangements

  • Site-directed spin labeling and electron paramagnetic resonance (EPR):

    • Introduce spin labels at specific positions

    • Measure distances between labeled residues in different functional states

  • Single-molecule Förster resonance energy transfer (smFRET):

    • Label the protein with donor and acceptor fluorophores

    • Monitor distance changes between labeled positions during catalysis in real-time

  • Molecular dynamics simulations:

    • Use the available structural information to model conformational changes

    • Simulate substrate binding and catalysis to predict dynamic behavior

These complementary approaches can provide insights into the conformational dynamics of Lnt and how they relate to its catalytic mechanism.

What are the major challenges in studying Azotobacter vinelandii Lnt and how can researchers overcome them?

Studying Azotobacter vinelandii Lnt presents several significant challenges:

  • Membrane protein expression and stability:

    • Challenge: Low expression yields and protein instability

    • Solution: Optimize expression using specialized vectors and host strains, screen multiple detergents for solubilization, and use stabilizing additives in buffers

  • Functional reconstitution:

    • Challenge: Maintaining enzymatic activity after purification

    • Solution: Carefully optimize lipid composition in reconstitution experiments and minimize exposure to harsh conditions during purification

  • Structural characterization:

    • Challenge: Obtaining high-resolution structural data

    • Solution: Try multiple crystallization conditions, consider lipidic cubic phase crystallization, or use cryo-electron microscopy as an alternative approach

  • Substrate specificity determination:

    • Challenge: Identifying natural substrates and determining specificity determinants

    • Solution: Use bioinformatic analysis to identify potential lipoprotein substrates in A. vinelandii, followed by experimental validation

  • Functional redundancy:

    • Challenge: Possible redundant pathways for lipoprotein maturation

    • Solution: Generate genetic knockouts and perform comprehensive lipidomic/proteomic analyses

How can researchers investigate the substrate specificity of Azotobacter vinelandii Lnt?

Understanding the substrate specificity of Azotobacter vinelandii Lnt requires a multifaceted approach:

  • Bioinformatic analysis:

    • Identify putative lipoprotein substrates in the A. vinelandii genome using prediction tools (LipoP, PRED-LIPO)

    • Compare lipobox sequences to identify potential specificity determinants

  • In vitro substrate screening:

    • Design a library of synthetic lipopeptides with variations in the lipobox sequence

    • Assess N-acylation efficiency using mass spectrometry

    • Develop a high-throughput assay to test multiple substrates

  • Structure-function studies:

    • Perform site-directed mutagenesis of residues potentially involved in substrate recognition

    • Assess the impact of mutations on activity toward different substrates

    • Use computational docking to predict substrate binding modes

  • Proteomics approaches:

    • Compare the lipoproteome of wild-type and lnt-deficient A. vinelandii strains

    • Identify differences in lipoprotein processing and abundance

    • Use mass spectrometry to directly analyze acylation patterns

A combination of these approaches would provide comprehensive insights into the substrate specificity determinants of A. vinelandii Lnt.

How does the function of Lnt relate to other protein modification systems in Azotobacter vinelandii?

Lnt functions as part of an integrated network of post-translational modification systems in Azotobacter vinelandii:

  • Lipoprotein maturation pathway:

    • Lnt catalyzes the final step in a three-enzyme pathway including Lgt (prolipoprotein diacylglyceryl transferase) and LspA (signal peptidase II)

    • This pathway is essential for proper localization and function of lipoproteins

  • Relationship to nitrogen fixation machinery:

    • A. vinelandii is known for its nitrogen fixation capabilities, which require numerous metalloproteins

    • Some lipoproteins may be involved in metal trafficking and homeostasis, as suggested by studies on molybdenum storage proteins

    • The nitrogenase accessory proteins may include lipoproteins that require Lnt processing

  • Membrane protein quality control:

    • Lnt likely interfaces with protein folding and quality control systems

    • Proper N-acylation may serve as a checkpoint for lipoprotein trafficking

  • Cell envelope integrity:

    • Lipoproteins processed by Lnt contribute to cell envelope integrity

    • This may be particularly important for A. vinelandii's resistance to desiccation and oxidative stress

Understanding these interconnections requires integrative approaches combining genetics, biochemistry, and systems biology.

What insights can molecular modeling provide about Azotobacter vinelandii Lnt mechanism and inhibitor design?

Molecular modeling can provide valuable insights into A. vinelandii Lnt's mechanism and potential inhibitor design:

  • Homology modeling and structure prediction:

    • Using the available amino acid sequence , researchers can build homology models based on crystalized Lnt structures from other bacteria

    • These models can predict the arrangement of transmembrane domains and the catalytic site

  • Substrate binding mode prediction:

    • Docking studies with synthetic lipopeptide substrates can reveal binding determinants

    • Molecular dynamics simulations can model the conformational changes during catalysis

  • Inhibitor design strategies:

    • Virtual screening of compound libraries against the catalytic site

    • Structure-based design of transition state analogs

    • Fragment-based approaches targeting allosteric sites

  • Specificity determinants:

    • Comparative modeling of Lnt from different species can identify unique features of the A. vinelandii enzyme

    • These features could be exploited for selective inhibitor design

The following table summarizes potential inhibitor design strategies based on molecular modeling:

StrategyTarget SiteAdvantagesChallenges
Competitive inhibitorsActive siteDirect blockage of catalysisHigh lipophilicity requirements
Allosteric inhibitorsRegulatory sitesMay offer higher specificityHarder to identify binding sites
Covalent modifiersCatalytic nucleophilesLong-lasting inhibitionPotential off-target effects
Interface disruptorsProtein-membrane interfaceNovel mechanism of actionComplex environment to model

These computational approaches, validated by experimental testing, can accelerate the development of tools to study Lnt function and potential antimicrobial compounds.

What are the most promising directions for future research on Azotobacter vinelandii Lnt?

Several high-priority research directions for Azotobacter vinelandii Lnt include:

  • Structural biology:

    • Determination of high-resolution structures in different conformational states

    • Characterization of substrate and lipid binding sites

    • Investigation of the conformational changes mentioned in search result

  • Systems biology integration:

    • Global analysis of the lipoproteome in A. vinelandii

    • Investigation of the role of Lnt in stress responses and nitrogen fixation

    • Comparison with other bacterial species to identify unique features

  • Synthetic biology applications:

    • Engineering of Lnt for production of novel lipopeptides

    • Development of biosensors based on lipoprotein modification

    • Creation of minimal lipoprotein processing systems for biotechnology

  • Evolutionary biology:

    • Analysis of Lnt evolution in different bacterial lineages

    • Investigation of functional redundancy and adaptation

    • Exploration of horizontal gene transfer patterns

  • Translational research:

    • Development of high-throughput screening systems for Lnt inhibitors

    • Investigation of Lnt as a potential target for antimicrobials

    • Exploitation of Lnt for development of novel vaccine adjuvants

Each of these directions builds on current knowledge while expanding into new territories with both fundamental and applied significance.

How might advances in studying A. vinelandii Lnt contribute to broader fields in molecular biology?

Research on Azotobacter vinelandii Lnt has potential to make significant contributions to broader fields:

  • Membrane protein biology:

    • New methodologies for expression and characterization of challenging membrane enzymes

    • Insights into membrane protein folding and stability

    • Understanding of lipid-protein interactions in complex membranes

  • Synthetic biology and protein engineering:

    • Development of tools for site-specific protein lipidation

    • Creation of novel bioconjugation methods based on Lnt mechanism

    • Engineering of synthetic lipoproteins with novel functions

  • Antimicrobial development:

    • Identification of a new target class unique to bacteria

    • Structure-guided design of species-selective inhibitors

    • Understanding of resistance mechanisms to Lnt inhibitors

  • Evolutionary biochemistry:

    • Insights into the adaptation of post-translational modification systems

    • Understanding of the co-evolution of enzymes and their substrates

    • Exploration of functional redundancy in essential cellular processes

Advances in these areas could have implications beyond basic research, potentially impacting biotechnology, medicine, and our understanding of fundamental biological processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.