Recombinant Azotobacter vinelandii Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Enzyme Characteristics and Functional Role

PlsY (UniProt ID: C1DIY2) is a membrane-associated protein encoded by the plsY gene in A. vinelandii. It belongs to the glycerol-3-phosphate acyltransferase (GPAT) family and plays a critical role in:

  • Lipid metabolism: Initiating phospholipid biosynthesis by acylating G3P .

  • Biopolymer synthesis: Contributing to polyhydroxybutyrate (PHB) and alginate production during nitrogen-free growth on glycerol .

  • Stress adaptation: Supporting cyst formation and drought resistance via membrane remodeling .

The enzyme exhibits substrate specificity for oleate (C18:1) over palmitate (C16:0), a trait conserved across bacterial GPATs .

Recombinant Production and Purification

Recombinant PlsY is produced in heterologous systems such as E. coli or yeast, with optimized protocols for yield and stability :

ParameterSpecification
Expression HostE. coli (BL21 strains) or Saccharomyces cerevisiae
TagN-terminal His-tag for affinity chromatography
Purity>85% (SDS-PAGE)
Molecular Weight~40–42 kDa (predicted)
Storage-20°C/-80°C (lyophilized: 12 months; liquid: 6 months)
Reconstitution0.1–1.0 mg/mL in Tris/PBS buffer with 5–50% glycerol

3.2. Catalytic Activity

SubstrateKm (μM)Vmax (nmol/min/mg)Preferred Acyl Donor
Glycerol-3-phosphate90–1,25015–22Oleoyl-ACP
Palmitoyl-ACPNot detected

Applications in Biopolymer Production

Recombinant PlsY facilitates nitrogen-free biosynthesis of industrially relevant polymers:

4.1. Polyhydroxybutyrate (PHB)

  • Yield: 33% of dry cell weight under glycerol-fed, nitrogen-limited conditions .

  • Pathway: Glycerol → G3P → acetyl-CoA → PHB via phbBAC operon .

4.2. Alginate

  • Production: Alginate-overproducing mutants achieve 2× higher yields (12 g/L) using glycerol .

  • Metabolic Link: Gluconeogenesis converts glycerol-derived intermediates to alginate precursors .

Research Advancements and Challenges

Recent studies highlight unresolved questions:

  • Oxygen sensitivity: Despite A. vinelandii’s aerobic metabolism, PlsY activity may require microaerobic conditions for optimal function .

  • Regulatory mechanisms: Expression is upregulated during glycerol metabolism but repressed by CbrA/Crc systems in glucose-rich environments .

  • Industrial scalability: Low solubility of recombinant PlsY in non-glycerol buffers remains a bottleneck .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific requirements for the format, please indicate them in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate this to us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
plsY; Avin_46960; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Target Names
plsY
Target Protein Sequence
MVWLLAILAYLLGSLSFAILLSQLSGGPDPRACGSGNPGTTNMLRIAGKRLAALTLLGDL GKGLLPVLIAQHAGLGVQQQAWIGLAAVSGHLYPLYFNFRGGKGVATAAGMLLGLYPPAV LPAVAAWLLVFAFTRTSSLAALAATPLCLPLLAWRQPEALLPMLLLYGVIVWRHRGNLHA LFAGRERHF
Uniprot No.

Target Background

Function
This enzyme catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). It utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Glycerol-3-phosphate acyltransferase (plsY) in Azotobacter vinelandii?

Glycerol-3-phosphate acyltransferase (plsY) in Azotobacter vinelandii is an essential enzyme that catalyzes the first step in membrane phospholipid biosynthesis. It specifically transfers an acyl group from acyl-ACP (acyl carrier protein) to the sn-1 position of glycerol-3-phosphate to form lysophosphatidic acid (LPA). This reaction represents the initial committed step in the glycerol phosphate pathway for phospholipid synthesis in bacteria. The enzyme belongs to the broader family of glycerol-3-phosphate acyltransferases that are critical for lipid metabolism across various organisms. In A. vinelandii, plsY plays a particularly important role in maintaining membrane integrity during both vegetative growth and differentiation into cysts, the desiccation-resistant resting stage of this bacterium .

How does glycerol-3-phosphate metabolism relate to A. vinelandii physiology?

Glycerol-3-phosphate metabolism is integrally connected to A. vinelandii's unique physiological capabilities. Research has demonstrated that A. vinelandii accumulates glycerol-3-phosphate during growth on glycerol, particularly in the exponential phase, followed by a significant decrease in its levels during stationary phase . This pattern suggests that glycerol-3-phosphate serves as a metabolic intermediate in this organism's adaptation to different growth conditions. The metabolism of glycerol-3-phosphate is linked not only to membrane lipid synthesis via plsY activity but also to the production of storage polymers and extracellular substances that contribute to A. vinelandii's survival strategies. Additionally, the phospholipid composition influenced by plsY activity likely affects membrane properties that are essential for nitrogen fixation, a defining characteristic of A. vinelandii.

What is the relationship between plsY activity and biopolymer production in A. vinelandii?

A. vinelandii is known for producing two important biopolymers: polyhydroxybutyrate (PHB) and alginate. Studies have shown that when grown on glycerol, A. vinelandii accumulates glycerol-3-phosphate, which can be directed toward either membrane lipid synthesis via plsY or toward alternative metabolic pathways that ultimately contribute to biopolymer synthesis . The partitioning of glycerol-3-phosphate between these competing pathways is likely influenced by environmental conditions and cellular metabolic status. Alginate, a major component of the A. vinelandii cyst coat, provides desiccation resistance and structural integrity. The production of alginate with specific properties (such as guluronic acid content) is essential for cyst formation and environmental resilience . While direct experimental evidence linking plsY activity to biopolymer production is limited, the shared use of precursor metabolites suggests a coordinated regulation of these processes.

How is plsY expression regulated in A. vinelandii?

The regulation of plsY expression in A. vinelandii likely involves multiple mechanisms responding to nutritional and environmental cues. While specific regulatory elements controlling plsY expression have not been fully characterized, insights can be drawn from related regulatory systems. A. vinelandii possesses unique regulatory mechanisms independent of the common NtrB/NtrC system found in other proteobacteria . The organism uses transcriptional antitermination regulators like NasT (containing an ANTAR domain) to control gene expression in response to nitrogen availability . Similar regulatory mechanisms might control plsY expression in coordination with metabolic demands. Additionally, the accumulation pattern of glycerol-3-phosphate during growth phases suggests that plsY expression or activity might be differentially regulated throughout the bacterial life cycle, possibly in connection with cyst formation and other differentiation processes characteristic of A. vinelandii.

What expression systems are optimal for producing recombinant A. vinelandii plsY?

  • Expression vector selection: Vectors providing tight regulation (such as pBAD systems with arabinose induction) help minimize toxicity issues that can arise from overexpression of membrane-active enzymes.

  • Host strain selection: C41(DE3) or C43(DE3) E. coli strains, derived from BL21(DE3), are engineered specifically for membrane protein expression and may provide better yields and proper folding.

  • Fusion tags: N-terminal His6 or MBP (maltose-binding protein) tags can improve solubility and facilitate purification while allowing for tag removal via engineered protease sites.

  • Expression conditions: Lower induction temperatures (16-20°C) and reduced inducer concentrations often improve folding and functional expression of membrane-associated enzymes.

  • Homologous expression: For studies requiring native post-translational modifications, expression within modified A. vinelandii strains can be achieved using approaches similar to those developed for lacZ fusion constructs in A. vinelandii .

Expression SystemAdvantagesChallengesOptimal Conditions
pET/E. coli BL21(DE3)High expression levelsPotential inclusion body formation16°C, 0.1-0.5 mM IPTG, 16-24h
pBAD/E. coli TOP10Titratable expressionLower yields20°C, 0.002-0.2% arabinose, 16-24h
pET/E. coli C41(DE3)Better for membrane proteinsStrain-specific optimization required20°C, 0.1 mM IPTG, 24h
A. vinelandii vectorNative modificationsTechnical complexityGrowth on Burk's medium, specific inducers

How can the enzymatic activity of recombinant A. vinelandii plsY be measured in vitro?

Measuring the enzymatic activity of recombinant A. vinelandii plsY requires careful consideration of substrate preparation, reaction conditions, and product detection methods. A comprehensive methodology would include:

  • Substrate preparation: Glycerol-3-phosphate can be commercially obtained, while acyl-ACP typically requires enzymatic synthesis. This can be achieved by converting free fatty acids to acyl-ACP using ACP synthase or through purification from bacterial sources.

  • Reaction buffer optimization: Typical conditions include Tris-HCl (pH 7.4-8.0), MgCl₂ (5-10 mM), and sometimes reducing agents like DTT or β-mercaptoethanol to maintain enzyme stability.

  • Detergent selection: As plsY interacts with hydrophobic substrates, mild detergents (0.01-0.05% Triton X-100 or 0.1% n-dodecyl-β-D-maltoside) are often needed to solubilize substrates without denaturing the enzyme.

  • Activity assay methods:

    • Radiometric assays: Using [¹⁴C]-labeled glycerol-3-phosphate or acyl-ACP allows sensitive detection of lysophosphatidic acid formation

    • Coupled enzyme assays: Monitoring ACP release using Ellman's reagent

    • HPLC-based methods: Separating and quantifying reaction products

    • Mass spectrometry: Providing detailed analysis of reaction products

  • Data analysis: Enzyme kinetics should be determined under initial rate conditions where product formation is linear with time and enzyme concentration.

ParameterRange to TestOptimal Conditions (Estimated)
pH6.5-8.57.4-7.8
Temperature25-45°C30-37°C
[Glycerol-3-phosphate]0.01-2 mM0.1-0.5 mM
[Acyl-ACP]0.01-0.5 mM0.05-0.1 mM
Divalent cationsMg²⁺, Mn²⁺, Ca²⁺ (1-10 mM)Mg²⁺ (5 mM)

How do environmental factors affect recombinant A. vinelandii plsY activity?

The activity of recombinant A. vinelandii plsY is subject to modulation by various environmental factors that researchers should consider when designing experiments and interpreting results:

  • Temperature effects: As A. vinelandii is a soil bacterium, its enzymes typically display optimal activity at moderate temperatures (25-35°C). At the molecular level, temperature affects both substrate binding kinetics and protein conformational stability. Systematic analysis of plsY activity across a temperature range (15-45°C) can reveal important insights into enzyme thermostability and activation energy requirements.

  • pH dependence: The catalytic mechanism of acyltransferases often involves charged amino acid residues whose protonation states are pH-dependent. A comprehensive pH profile (pH 5.5-9.0) can identify optimal conditions and provide mechanistic insights into the catalytic residues involved.

  • Ionic strength and metal ion requirements: Divalent cations (particularly Mg²⁺) often serve as cofactors for acyltransferases, facilitating substrate binding or directly participating in catalysis. Testing various concentrations and types of metal ions can reveal specific requirements.

  • Oxygen sensitivity: As A. vinelandii is an aerobic nitrogen-fixer with specialized mechanisms to protect oxygen-sensitive processes, its enzymes may display unique oxygen tolerance profiles that should be characterized.

  • Substrate availability effects: Under different environmental conditions, the predominant fatty acid composition in A. vinelandii changes, potentially affecting the substrate preference of plsY. Characterizing enzyme activity with various acyl-ACP substrates differing in chain length and saturation can provide insights into the enzyme's adaptive role.

Environmental FactorTesting RangeExpected Impact on Activity
Temperature15-45°CBell-shaped curve with optimum around 30°C
pH5.5-9.0Optimal activity likely between pH 7.0-8.0
Oxygen exposure0-100% air saturationPotential moderate sensitivity
Metal ionsVarious concentrations of Mg²⁺, Mn²⁺, Ca²⁺, Zn²⁺Specific requirements for Mg²⁺ likely
Ionic strength50-500 mM NaClModerate sensitivity expected

How can structural biology approaches enhance our understanding of A. vinelandii plsY?

Structural biology approaches offer powerful tools to elucidate the molecular basis of A. vinelandii plsY function, substrate specificity, and potential for biotechnological applications:

  • Homology modeling and sequence analysis: While no crystal structure exists specifically for A. vinelandii plsY, structures of homologous bacterial plsY proteins can serve as templates for computational modeling. Sequence alignment with characterized plsY enzymes from other bacteria can identify conserved catalytic residues and substrate-binding motifs specific to A. vinelandii.

  • Protein crystallography: Obtaining a high-resolution crystal structure requires:

    • Protein engineering to remove flexible regions that might impede crystallization

    • Screening numerous crystallization conditions with various precipitants, buffers, and additives

    • Co-crystallization with substrates or substrate analogs to capture enzyme-substrate complexes

    • Crystallization in lipidic cubic phases for this membrane-associated protein

  • Cryo-electron microscopy (cryo-EM): For challenging membrane proteins like plsY, cryo-EM provides an alternative approach to crystallography, potentially revealing structural details without the need for crystal formation.

  • Site-directed mutagenesis guided by structural insights: Creating specific mutations at predicted catalytic and substrate-binding sites can validate structural models and provide mechanistic insights. A systematic mutagenesis approach targeting conserved residues can identify those critical for:

    • Substrate binding

    • Catalysis

    • Membrane association

    • Protein stability

  • Molecular dynamics simulations: Computational approaches can reveal dynamic aspects of protein-substrate interactions, conformational changes during catalysis, and how the enzyme interacts with membrane environments.

What are the optimal purification strategies for recombinant A. vinelandii plsY?

Purifying recombinant A. vinelandii plsY requires specialized approaches due to its membrane-associated nature. The following comprehensive purification strategy addresses the challenges specific to this class of enzymes:

  • Membrane preparation: After cell lysis (typically via French press or sonication), differential centrifugation can separate membrane fractions containing plsY. Low-speed centrifugation (5,000-10,000 × g) removes cell debris, followed by high-speed ultracentrifugation (100,000-150,000 × g) to pellet membrane fractions.

  • Detergent screening: Testing multiple detergents is critical for optimal solubilization while maintaining enzyme activity:

    • Mild detergents (n-dodecyl-β-D-maltoside, digitonin, CHAPS) often preserve activity

    • Detergent concentration optimization is essential (typically 1-2% for solubilization, 0.01-0.1% for purification steps)

    • Extracting membrane proteins in a detergent-lipid mixed micelle system can enhance stability

  • Affinity chromatography: Utilizing fusion tags for selective purification:

    • His-tagged proteins can be purified using Ni-NTA resins with imidazole gradients for elution

    • On-column detergent exchange can be performed during washing steps

    • Adding phospholipids to purification buffers may enhance stability

  • Size exclusion chromatography: A final polishing step separates aggregates and provides information about the oligomeric state of the purified enzyme in detergent micelles.

  • Activity preservation strategies:

    • Addition of glycerol (10-20%) to all buffers

    • Inclusion of reducing agents (1-5 mM DTT or TCEP)

    • Maintaining low temperatures (4°C) throughout purification

    • Reconstitution into liposomes or nanodiscs for long-term storage and functional studies

Purification StepConditionsExpected Results
Membrane isolation100,000 × g, 1h, 4°CMembrane pellet containing plsY
Solubilization1% DDM, 1h, 4°CSolubilized active enzyme
Ni-NTA chromatography20-250 mM imidazole gradient>80% purity
Size exclusionSuperdex 200, 0.05% DDM>95% purity, separation of oligomeric states
ReconstitutionE. coli lipids, 4:1 lipid:proteinStable, active enzyme preparation

How can CRISPR-Cas9 be used to modify plsY in A. vinelandii for functional studies?

CRISPR-Cas9 gene editing offers powerful approaches for investigating plsY function in A. vinelandii through precise genetic modifications. The following methodology outlines a comprehensive strategy:

  • sgRNA design considerations for A. vinelandii plsY:

    • Target sequences must be adjacent to A. vinelandii PAM sequences (typically NGG for Cas9)

    • Multiple sgRNAs should be designed and tested for efficiency

    • Off-target prediction should account for the A. vinelandii genome context

    • Target regions critical for catalysis based on sequence homology to characterized plsY enzymes

  • Delivery methods optimized for A. vinelandii:

    • Electroporation protocols must be optimized specifically for A. vinelandii

    • Temperature-sensitive plasmids can facilitate removal of CRISPR components after editing

    • Conjugation-based delivery systems may provide alternatives for difficult-to-transform strains

  • Homology-directed repair templates for precise modifications:

    • Homology arms of 500-1000 bp typically provide efficient recombination

    • Point mutations can be introduced to create catalytically inactive variants

    • Fluorescent protein fusions can be created for localization studies

    • Epitope tags can be added for immunoprecipitation and protein interaction studies

  • Screening strategies for successful editing:

    • PCR-based screening followed by sequencing verification

    • Phenotypic screening based on predicted effects of plsY modification

    • Western blotting for tagged versions

  • Anticipated challenges specific to A. vinelandii:

    • The essential nature of plsY may require conditional approaches

    • The complex life cycle including cyst formation may complicate phenotypic analysis

    • Natural competence and recombination mechanisms in A. vinelandii may interfere with precise editing

Modification TypePurposeDesign Considerations
Catalytic site mutationsStructure-function analysisTarget conserved HX₄D motif
Conditional expressionStudying essentialityInclude inducible promoter systems
Fluorescent fusionLocalization studiesC-terminal fusions typically less disruptive
Substrate specificity variantsAltering acyl chain preferenceTarget residues in substrate binding pocket
Domain swappingChimeric enzyme analysisMaintain conserved structural elements

What analytical techniques are most effective for characterizing the products of A. vinelandii plsY?

The products of the A. vinelandii plsY reaction, primarily lysophosphatidic acid species, require sophisticated analytical approaches for comprehensive characterization:

  • Chromatographic methods:

    • Thin-layer chromatography (TLC): Provides rapid screening of reaction products

    • High-performance liquid chromatography (HPLC): Enables quantitative analysis with UV or evaporative light-scattering detection

    • Ultra-performance liquid chromatography (UPLC): Offers superior resolution of closely related lipid species

  • Mass spectrometry approaches:

    • Electrospray ionization mass spectrometry (ESI-MS): Allows precise molecular weight determination

    • Tandem MS (MS/MS): Provides structural information through fragmentation patterns

    • MALDI-TOF: Useful for higher molecular weight products or complexes

    • LC-MS/MS: Combines chromatographic separation with detailed structural analysis

  • Nuclear magnetic resonance (NMR) spectroscopy:

    • ¹H-NMR: Provides information about proton environments and acyl chain characteristics

    • ³¹P-NMR: Specifically useful for phospholipid analysis

    • 2D-NMR techniques: Offer detailed structural information for complex lipids

  • Enzymatic approaches:

    • Coupled enzyme assays using lysophosphatidic acid acyltransferases

    • Phospholipase-based degradation followed by analysis of fragments

  • Sample preparation considerations:

    • Lipid extraction methods (Bligh-Dyer or Folch procedures)

    • Derivatization strategies to enhance detection sensitivity

    • Internal standards for quantification

Analytical TechniqueInformation ProvidedSample Requirements
HPLC-ELSDQuantification, acyl chain distribution10-100 μg lipid
LC-MS/MSMolecular species identification, structure1-10 μg lipid
³¹P-NMRPhosphate group environment, purity100-500 μg lipid
TLCRapid screening, reaction monitoring5-50 μg lipid
GC-MS (after derivatization)Fatty acid composition analysis10-50 μg lipid

How does A. vinelandii plsY compare with homologous enzymes from other bacteria?

A comparative analysis of A. vinelandii plsY with homologous enzymes from other bacteria reveals important evolutionary and functional insights:

  • Sequence conservation patterns: Alignment of plsY sequences across diverse bacterial species typically reveals:

    • A highly conserved HX₄D catalytic motif essential for acyltransferase activity

    • Variable regions that may confer species-specific substrate preferences

    • Membrane-association domains with more sequence diversity than catalytic regions

    • A. vinelandii plsY likely contains unique sequence elements related to its soil habitat and cyst-forming lifecycle

  • Structural comparisons: Based on structures of homologous enzymes, A. vinelandii plsY likely features:

    • A seven-transmembrane domain architecture typical of bacterial plsY enzymes

    • A cytoplasmic active site accessible to water-soluble substrates

    • Specific binding pockets that accommodate the fatty acyl chain structure preferred by A. vinelandii

  • Substrate specificity differences: Various bacterial species show distinct preferences for acyl-ACP chain length and saturation:

    • Soil bacteria often accommodate a broader range of substrates than specialized pathogens

    • A. vinelandii likely shows preferences aligned with its membrane composition requirements

    • The nitrogen-fixing lifestyle may influence membrane fluidity needs and corresponding enzyme specificity

  • Regulatory contexts: Gene organization and regulation of plsY varies across bacterial species:

    • In many bacteria, plsY is co-regulated with other phospholipid synthesis genes

    • A. vinelandii may show unique regulatory patterns connected to its complex lifecycle

    • Promoter analysis could reveal nitrogen-responsive or cyst-specific regulatory elements

Bacterial SpeciesKey plsY FeaturesEvolutionary Significance
A. vinelandiiLikely broad substrate specificity, potential regulatory connections to cyst formationAdaptation to soil environment with fluctuating conditions
E. coliWell-characterized, moderate substrate rangeModel system for basic plsY function
Pseudomonas speciesRelated to A. vinelandii, may share regulatory featuresEvolutionary connection to A. vinelandii as γ-proteobacteria
Gram-positive bacteriaMore distant homologs with distinct membrane compositionDivergent evolution reflecting fundamental membrane differences

How might plsY function interface with nitrogen fixation in A. vinelandii?

The relationship between plsY function and nitrogen fixation in A. vinelandii represents an intriguing intersection of membrane metabolism and this bacterium's defining physiological capability:

  • Membrane requirements for nitrogenase protection: A. vinelandii's nitrogenase is highly oxygen-sensitive, yet the bacterium fixes nitrogen aerobically. This requires:

    • Specialized membrane structures and compositions that may be influenced by plsY activity

    • High respiratory rates that depend on proper membrane organization

    • Potential membrane microdomains with specific lipid compositions for respiratory complexes

  • Energetic considerations: Nitrogen fixation is energetically expensive, requiring:

    • Efficient energy transduction across membranes

    • Phospholipid compositions that support optimal ATP generation

    • Metabolic coordination between carbon flux to lipids versus nitrogen fixation

  • Regulatory integration: A. vinelandii has unique regulatory mechanisms for nitrogen fixation:

    • Independence from the common NtrB/NtrC regulatory system

    • Potential co-regulation of membrane composition and nitrogen fixation genes

    • Transcriptional antitermination mechanisms similar to those found in the nasAB system may influence plsY expression

  • Cyst formation connections: Both nitrogen status and membrane remodeling are involved in cyst formation:

    • Alginate production is essential for cyst formation and desiccation resistance

    • Phospholipid remodeling during differentiation likely involves altered plsY activity

    • Nutrient limitation signals that trigger cyst formation may simultaneously affect lipid metabolism

While direct experimental evidence linking plsY function to nitrogen fixation is limited, the fundamental role of membrane composition in cellular energetics provides a strong theoretical basis for such connections. Future studies combining lipidomics with nitrogen fixation assays under various conditions could elucidate these relationships.

What emerging technologies could advance A. vinelandii plsY research?

Several cutting-edge technologies hold promise for advancing our understanding of A. vinelandii plsY and its role in bacterial physiology:

  • Cryo-electron tomography: This technique can visualize membrane structures in near-native states, potentially revealing:

    • Spatial organization of plsY within the bacterial membrane

    • Membrane remodeling during cyst formation

    • Co-localization with other lipid biosynthetic enzymes

  • Single-molecule enzymology: Advanced fluorescence techniques could:

    • Track individual enzyme molecules during catalysis

    • Reveal conformational dynamics during substrate binding

    • Identify rate-limiting steps in the catalytic cycle

  • Synthetic biology approaches:

    • Minimal membrane systems incorporating purified plsY

    • Reconstitution of entire phospholipid synthesis pathways in vitro

    • Creation of chimeric enzymes to probe domain functions

  • Systems biology integration:

    • Multi-omics approaches connecting lipidome, transcriptome, and proteome data

    • Flux analysis of carbon through competing pathways

    • Computational modeling of membrane dynamics based on plsY activity

  • Nanoscale biophysical techniques:

    • Atomic force microscopy to study enzyme-membrane interactions

    • Surface plasmon resonance for precise binding kinetics

    • Native mass spectrometry for protein-lipid complex analysis

The integration of these technologies with traditional biochemical and molecular approaches would provide unprecedented insights into the structure, function, and physiological role of A. vinelandii plsY, particularly in the context of this bacterium's unique capabilities for nitrogen fixation and differentiation.

What are the key unresolved questions regarding A. vinelandii plsY?

Despite advances in understanding bacterial glycerol-3-phosphate acyltransferases, several critical questions remain unanswered specific to A. vinelandii plsY:

  • Structure-function relationships:

    • What structural features determine substrate specificity in A. vinelandii plsY?

    • How does the enzyme architecture change during catalysis?

    • What protein-protein interactions might modulate its activity in vivo?

  • Regulatory mechanisms:

    • How is plsY expression regulated during different growth phases and cyst formation?

    • What transcription factors directly control plsY expression?

    • How do nitrogen status and oxygen tension affect plsY activity?

  • Metabolic integration:

    • How is carbon flux balanced between phospholipid synthesis and alginate/PHB production?

    • What metabolic signals coordinate these competing pathways?

    • How does plsY activity respond to changes in fatty acid availability?

  • Evolutionary aspects:

    • What selective pressures shaped the specific properties of A. vinelandii plsY?

    • How has horizontal gene transfer influenced plsY evolution in soil bacteria?

    • What unique adaptations in A. vinelandii plsY support its lifestyle compared to related bacteria?

  • Technological applications:

    • Can A. vinelandii plsY be engineered for novel substrate specificities?

    • Could the enzyme be utilized for biocatalytic production of specialized phospholipids?

    • What insights from A. vinelandii plsY could inform synthetic membrane development?

Addressing these questions will require interdisciplinary approaches combining structural biology, biochemistry, genetics, and systems biology. The answers will not only enhance our understanding of A. vinelandii physiology but could also provide insights applicable to other bacterial systems and potential biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.