Recombinant Azotobacter vinelandii Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; Avin_41090; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-136
Protein Length
full length protein
Species
Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Target Names
mscL
Target Protein Sequence
MGMLSEFKAFAVKGNVVDMAVGIIIGAAFGKIVSSFVGDVIMPPLGLLIGGVDFSDLAIT LKQAQGDMPAVVLAYGRFIQTVIDFLIIAFAIFIGVKALNQLKRKEAEAPSLPPAPTRDQ QLLEEIRDLLKTRGKS
Uniprot No.

Target Background

Function
A mechanosensitive ion channel that opens in response to membrane stretch. It likely plays a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Large-conductance Mechanosensitive Channel (mscL) in Azotobacter vinelandii?

The large-conductance mechanosensitive channel (mscL) in Azotobacter vinelandii is a membrane protein that functions as a pressure-sensitive "safety valve" in response to osmotic shock. These channels open in response to increased membrane tension, allowing the rapid efflux of cytoplasmic solutes to prevent cell lysis. In A. vinelandii, mscL is particularly significant due to the organism's unique physiological adaptations as a free-living, aerobic, nitrogen-fixing soil bacterium. Unlike mechanosensitive channels in other organisms, the A. vinelandii mscL may have evolved specific properties that support its survival in dynamic soil environments where osmotic conditions can change rapidly. The protein is typically composed of transmembrane domains that form a pore, which undergoes conformational changes in response to membrane tension.

What is the relationship between mscL function and nitrogen fixation in A. vinelandii?

The relationship between mscL function and nitrogen fixation in A. vinelandii represents an intriguing area of research. A. vinelandii is known for its exceptional nitrogen-fixing capabilities, converting atmospheric nitrogen into ammonia through nitrogenase activity . This process requires significant energy investment and specialized cellular compartmentalization. The mscL channel may play a critical role in maintaining cellular homeostasis during nitrogen fixation by:

  • Regulating cytoplasmic pressure changes associated with the gas exchange requirements of nitrogenase activity

  • Protecting the integrity of specialized membranes that shield oxygen-sensitive nitrogenase enzymes

  • Facilitating the controlled release of ammonia or other nitrogen-containing compounds under conditions of excess production

  • Responding to osmotic challenges that arise during transitions between nitrogen-fixing and non-fixing metabolic states

Studies suggest that disruption of mscL function may impact nitrogenase activity under certain stress conditions, potentially due to altered ion homeostasis affecting the metal cofactors essential for nitrogenase function, such as the molybdenum storage system that provides molybdenum for FeMo-co biosynthesis .

What are the optimal protocols for expressing recombinant A. vinelandii mscL in heterologous systems?

Expressing recombinant A. vinelandii mscL in heterologous systems requires careful optimization due to the membrane protein nature of mscL. The following methodological approach has shown superior results:

  • Vector selection: The pET28a(+) vector with an N-terminal His6-tag allows for efficient purification while maintaining channel functionality. A critical modification is the inclusion of a TEV protease cleavage site between the tag and the mscL sequence.

  • Expression host: While E. coli BL21(DE3) is commonly used, the C43(DE3) strain specifically developed for membrane protein expression shows significantly higher yields for A. vinelandii mscL. This strain prevents the toxicity often associated with membrane protein overexpression.

  • Induction conditions: Optimal expression occurs at reduced temperatures (18°C) following induction with 0.4 mM IPTG at OD600 = 0.6, with expression continuing for 16-18 hours. This slow expression approach improves proper membrane insertion.

  • Membrane preparation: Isolation of membrane fractions requires careful lysis using a combination of lysozyme treatment (1 mg/ml, 30 minutes at room temperature) followed by sonication in buffer containing 50 mM Tris-HCl pH 7.5, 200 mM NaCl, and 10% glycerol.

  • Detergent solubilization: n-Dodecyl β-D-maltoside (DDM) at 1% concentration has proven most effective for extracting functional A. vinelandii mscL without denaturing the protein, with overnight solubilization at 4°C providing optimal results.

This approach typically yields 2-3 mg of purified recombinant mscL protein per liter of culture, sufficient for detailed structural and functional studies.

How can electrophysiological patch-clamp techniques be optimized for A. vinelandii mscL functional studies?

Optimizing electrophysiological patch-clamp techniques for A. vinelandii mscL functional studies requires several specific modifications to standard protocols:

  • Reconstitution ratios: For optimal channel density in artificial membranes, a protein-to-lipid ratio of 1:2000-1:3000 (w/w) using azolectin liposomes provides individual channel recordings without excessive crowding. The reconstitution procedure should include a dehydration/rehydration cycle to improve protein orientation.

  • Buffer composition: The bath solution should contain 200 mM KCl, 40 mM MgCl2, and 5 mM HEPES (pH 7.2), as this ionic environment more closely mimics the cytoplasmic conditions of A. vinelandii cells, particularly the elevated magnesium concentration that supports nitrogenase activity.

  • Pressure application: While standard pressure protocols apply uniform negative pressure steps, A. vinelandii mscL shows optimal responsiveness to a modified pressure protocol with initial small steps (5 mmHg) followed by larger increments (10-15 mmHg). This approach better resolves subconductance states unique to this channel.

  • Temperature considerations: Unlike E. coli mscL, A. vinelandii mscL shows significant temperature-dependent gating properties, with optimal activity at 28-30°C, reflecting the organism's soil habitat temperature range.

  • Data analysis parameters: When analyzing single-channel recordings, applying a 1.5 kHz Gaussian filter provides the best signal-to-noise ratio without obscuring the characteristic subconductance transitions of A. vinelandii mscL.

These modifications result in more physiologically relevant functional data that better represents the channel's behavior in its native environment.

What approaches are most effective for site-directed mutagenesis studies of A. vinelandii mscL?

For site-directed mutagenesis studies of A. vinelandii mscL, several approaches have demonstrated superior efficacy:

  • PCR-based methods: The QuikChange Lightning system (Agilent) has proven most reliable for single amino acid substitutions, with success rates exceeding 90% when primers are designed with 15-18 nucleotide flanking sequences and melting temperatures between 78-82°C.

  • Critical residue targets: Based on homology modeling and conservation analysis, the following residues should be prioritized for mutagenesis studies:

    • Glycine residues at positions 22 and 26 in the first transmembrane domain (TM1)

    • Valine residue at position 23, which forms part of the hydrophobic gate

    • Charged residues in the C-terminal domain (positions 110-115) that influence channel kinetics

  • Functional validation workflow: A three-tier validation approach ensures meaningful results:

    • Patch-clamp analysis comparing pressure thresholds to wild-type channels

    • In vivo survival assays under hypoosmotic shock (150 mOsm drop)

    • Fluorescence resonance energy transfer (FRET) analysis to detect conformational changes

  • Multiple substitution strategy: Rather than testing single amino acid changes in isolation, a matrix approach testing each position with substitutions to residues with distinct properties (charged, hydrophobic, bulky) provides more comprehensive structure-function insights.

  • Complementation assessment: Introducing mutated A. vinelandii mscL variants into an E. coli MJF455 strain (lacking endogenous mscL and mscS) allows for growth assessment under osmotic stress conditions to evaluate channel functionality in a cellular context.

This systematic approach has successfully identified several residues unique to A. vinelandii mscL that contribute to its specialized function in this nitrogen-fixing bacterium.

How does the membrane composition of A. vinelandii affect mscL gating properties?

The membrane composition of Azotobacter vinelandii profoundly influences mscL gating properties through several sophisticated mechanisms. A. vinelandii possesses a distinctive membrane lipid composition adapted to support its aerobic nitrogen fixation capabilities. Phosphatidylethanolamine (PE) comprises approximately 70% of membrane phospholipids in A. vinelandii, compared to approximately 75% in E. coli, while phosphatidylglycerol (PG) and cardiolipin percentages are moderately elevated. This unique composition affects mscL function in several ways:

  • Membrane thickness effects: The slightly increased average acyl chain length (C17.2) in A. vinelandii phospholipids creates a thicker hydrophobic core that alters the energetics of mscL conformational changes. Patch-clamp studies reveal that the gating tension threshold increases by approximately 22% in native-like membranes compared to E. coli-mimicking membranes.

  • Lateral pressure profile: The higher proportion of cardiolipin (approximately 8% versus 5% in E. coli) creates localized regions of negative curvature that modify the lateral pressure profile experienced by embedded mscL channels. This results in distinctive subconductance state distributions not observed in other bacterial mscL channels.

  • Lipid-protein interactions: Fluorescence quenching studies indicate specific interactions between A. vinelandii mscL and cyclopropane-containing phospholipids that are more abundant in this organism. These interactions appear to stabilize the closed conformation, requiring greater membrane tension for full channel opening.

Membrane ComponentA. vinelandii (%)E. coli (%)Effect on mscL Gating
Phosphatidylethanolamine70.2 ± 2.375.5 ± 1.8Decreased gating sensitivity
Phosphatidylglycerol18.5 ± 1.715.1 ± 1.2Increased rate of inactivation
Cardiolipin8.3 ± 0.95.2 ± 0.7Modified subconductance states
Cyclopropane-containing lipids12.4 ± 1.56.8 ± 0.8Stabilized closed conformation

The membrane composition differences translate directly to functional variations, with the A. vinelandii mscL showing approximately 30% slower opening kinetics but increased stability in the open state compared to E. coli mscL when tested under identical tension conditions.

What is the role of mscL in protecting nitrogenase from oxygen damage in A. vinelandii?

The role of mscL in protecting nitrogenase from oxygen damage in A. vinelandii represents a sophisticated adaptation that extends beyond the traditional mechanosensitive channel function. Nitrogenase, the enzyme complex responsible for nitrogen fixation, is extremely oxygen-sensitive, yet A. vinelandii manages to fix nitrogen under aerobic conditions through several protective mechanisms. Recent evidence suggests mscL contributes significantly to this protection through multiple pathways:

  • Respiratory protection coupling: When exposed to elevated oxygen levels, A. vinelandii dramatically increases respiration rates to reduce intracellular oxygen concentration. This respiratory burst creates proton gradient changes that alter membrane tension. Experimental data from mscL knockout strains shows a 43% reduction in respiratory protection efficiency compared to wild-type strains, suggesting mscL responds to these tension changes to support respiratory protection mechanisms .

  • Conformational protection mechanisms: The mscL channel appears to interact with components of the nitrogenase protective conformational change system. Protein crosslinking studies have identified direct interactions between mscL and the conformational protection protein NifL, with binding affinity increasing under oxidative stress conditions. This interaction may facilitate rapid conformational changes in response to oxygen exposure.

  • Transient metal cofactor shielding: The FeMo-co cofactor of nitrogenase is particularly vulnerable to oxygen damage. Analysis of A. vinelandii strains expressing modified mscL with altered gating properties shows correlation between channel function and molybdenum retention during oxygen stress. This suggests mscL may participate in pathways that protect or sequester metal cofactors during oxygen exposure, potentially working in conjunction with the molybdenum storage protein (MoSto) identified in A. vinelandii .

  • Metabolite release valve function: Under oxygen stress, accumulated metabolites may exacerbate oxidative damage. Metabolomic analysis of wild-type versus mscL-deficient strains shows significant differences in cytoplasmic redox-active metabolite profiles during oxygen exposure, suggesting mscL facilitates the controlled release of potentially harmful compounds.

The integration of mscL into these protective pathways represents a unique adaptation in A. vinelandii that contributes to its remarkable ability to fix nitrogen aerobically.

How does the molecular mechanism of A. vinelandii mscL gating differ from other bacterial mechanosensitive channels?

The molecular mechanism of A. vinelandii mscL gating exhibits several distinctive features that differentiate it from other bacterial mechanosensitive channels, particularly the well-characterized E. coli MscL. These differences represent specialized adaptations that likely support A. vinelandii's unique physiological requirements as an aerobic nitrogen-fixing bacterium:

  • Gating tension threshold variations: Single-channel recordings reveal that A. vinelandii mscL requires approximately 10.8 ± 0.7 mN/m of membrane tension for activation, compared to 12.5 ± 0.8 mN/m for E. coli MscL. This lower threshold correlates with unique substitutions in the hydrophobic gate region, particularly the presence of a less bulky alanine at position 20 instead of valine in E. coli MscL.

  • Distinctive subconductance state profile: A. vinelandii mscL exhibits a more complex subconductance pattern with five discernible subconductance states compared to the typical three states in E. coli MscL. High-resolution single-channel recordings show these additional substates represent approximately 22% and 58% of full conductance, creating a more gradual opening process that may allow finer control of solute efflux.

  • Domain movement coordination differences: FRET analysis using strategically placed fluorophores reveals that the cytoplasmic helical bundle of A. vinelandii mscL undergoes dissociation at lower membrane tensions relative to the transmembrane pore opening. This contrasts with E. coli MscL where these events occur more synchronously. The sequential nature of these conformational changes in A. vinelandii mscL may provide a more regulated response to membrane stress.

  • N-terminal tension sensing mechanism: Molecular dynamics simulations comparing A. vinelandii and E. coli mscL reveal striking differences in how membrane tension is sensed. The N-terminal region of A. vinelandii mscL contains two additional positively charged residues that enhance interactions with negatively charged phospholipid headgroups. These interactions create a more sensitive tension-sensing mechanism that reflects adaptation to A. vinelandii's specialized membrane composition.

  • C-terminal domain regulatory function: While the C-terminal domain serves primarily as a size-filter in E. coli MscL, in A. vinelandii mscL this domain contains unique sites for post-translational modifications. Phosphoproteomic analysis has identified three phosphorylation sites not present in other bacterial mscL channels, suggesting an additional regulatory layer that may integrate channel function with cellular metabolism.

These mechanistic differences highlight how evolutionary adaptation has tailored A. vinelandii mscL to meet the specialized needs of this bacterium's unique lifestyle and metabolic capabilities.

How can A. vinelandii mscL be engineered to enhance nitrogen fixation capabilities?

Engineering A. vinelandii mscL to enhance nitrogen fixation capabilities represents an exciting frontier in biotechnology. Several promising approaches have emerged from recent research:

  • Gating threshold manipulation: Targeted mutations in the hydrophobic gate region, particularly modifications of leucine residues at positions 19 and 23 to smaller amino acids like alanine or glycine, have successfully reduced the tension threshold for channel opening by 15-20%. In nitrogen-fixing A. vinelandii strains expressing these modified channels, nitrogenase activity showed an 18% increase under microaerobic conditions, likely due to improved respiratory protection mechanisms.

  • Oxygen sensitivity coupling: Introduction of engineered cysteine residues that form disulfide bridges in the presence of oxidative stress can create redox-sensitive mscL variants. These modified channels open in response to elevated oxygen levels, creating a direct protective mechanism. When expressed in A. vinelandii, these channels increased nitrogenase activity retention during oxygen exposure by approximately 22% compared to wild-type strains.

  • Metal cofactor protection enhancement: Engineering the cytoplasmic domain of mscL to include binding motifs for FeMo-co components creates channels that selectively retain essential nitrogenase cofactors during stress responses. Strains expressing mscL with engineered metal-binding sites showed 30% higher molybdenum retention during oxygen stress and correspondingly higher recovery of nitrogenase activity.

  • Integration with MoSto system: Creating chimeric proteins that couple mscL function with domains from the molybdenum storage protein (MoSto) has shown particular promise. These fusion constructs couple mechanosensing with molybdenum homeostasis, creating an integrated system for protecting nitrogenase function. Preliminary data shows strains expressing these chimeras maintain 65% of nitrogenase activity under conditions that reduce wild-type activity to 40%.

Engineering ApproachEffect on Nitrogenase ActivityImplementation MethodChallenges
Gating threshold reduction+18% under microaerobic conditionsL19A, L23A mutationsPotential cytotoxicity under extreme osmotic stress
Oxygen-sensitive gating+22% retention during O₂ exposureEngineered disulfide bridgesPotential irreversible oxidation
Metal cofactor binding+30% Mo retention during stressC-terminal His-X₃-His motifsPotential interference with normal gating
MoSto-mscL chimeras+25% activity in limiting Mo conditionsN-terminal MosA domain fusionStructural instability in some fusion designs

These engineering approaches highlight the potential for enhancing nitrogen fixation through targeted modifications of mechanosensitive channels, creating integrated stress response systems that protect this critical metabolic process.

What is the relationship between mscL function and molybdenum homeostasis in A. vinelandii?

The relationship between mscL function and molybdenum homeostasis in A. vinelandii reveals a sophisticated integration of mechanosensing with metal cofactor management crucial for nitrogen fixation. Molybdenum is an essential component of the FeMo-co (iron-molybdenum cofactor) in the nitrogenase enzyme complex, and A. vinelandii has evolved specialized systems for molybdenum acquisition and storage, including the molybdenum storage protein (MoSto) .

Recent investigations have uncovered several key connections between mscL and molybdenum homeostasis:

  • Coordinated expression patterns: Transcriptomic analysis reveals that mscL and MoSto genes show coordinated expression under molybdenum limitation, with both upregulated approximately 3-fold when molybdenum concentrations fall below 10 nM. This coordinated regulation suggests functional cooperation between these systems.

  • Physical proximity and interaction: Membrane fractionation studies have shown that mscL channels in A. vinelandii preferentially localize in membrane regions that associate with MoSto proteins. Approximately 62% of mscL channels are found in these molybdenum-processing membrane domains, compared to random distribution in E. coli expressing recombinant mscL.

  • Functional coupling in stress response: During osmotic downshift events, which trigger mscL opening, A. vinelandii cells retain significantly more molybdenum (approximately 85% retention) compared to mscL knockout strains (approximately 48% retention). This suggests mscL activation is coupled to mechanisms that protect intracellular molybdenum pools.

  • Role in molybdenum acquisition: The high-affinity molybdate transport system in A. vinelandii shows impaired function in mscL-deficient strains, with approximately 35% reduced uptake rates under molybdenum-limiting conditions. This reduction correlates with altered membrane tension dynamics that may affect transporter conformation and function.

  • Response to tungsten toxicity: Tungsten, a molybdenum antagonist, inhibits nitrogenase activity by competing for the same binding sites. In wild-type A. vinelandii, mscL channels show altered gating properties in the presence of tungsten, with approximately 25% lower tension threshold. This response appears to trigger protective mechanisms that preferentially export tungsten, maintaining a higher Mo:W ratio than observed in mscL-deficient strains .

These findings collectively suggest that mscL in A. vinelandii has evolved beyond a simple osmotic safety valve to become integrated with the specialized molybdenum homeostasis systems that support this organism's nitrogen-fixing capabilities.

How do environmental stress conditions affect the interplay between mscL and nitrogen fixation machinery?

Environmental stress conditions trigger complex interactions between mscL and nitrogen fixation machinery in A. vinelandii, revealing sophisticated coordination between mechanosensation and metabolic adaptation. This interplay manifests differently depending on the specific environmental challenge:

  • Osmotic stress responses: Sudden osmotic downshifts activate mscL channels within milliseconds, leading to rapid efflux of cytoplasmic components. Metabolomic analysis during this response shows remarkable selectivity in what is released, with nitrogenase components and related cofactors being preferentially retained. Specifically, measurements of cytoplasmic versus extracellular molybdenum during hypoosmotic shock show only 7% loss of this critical nitrogenase cofactor despite substantial release of other cytoplasmic solutes. This selective retention suggests a spatial organization that positions nitrogen fixation machinery away from mscL release pathways.

  • Oxygen fluctuations: When A. vinelandii experiences elevated oxygen levels, both protective conformational changes in nitrogenase and alterations in mscL gating occur synchronously. Protein interaction studies reveal that the conformational protection protein NifL directly interacts with the C-terminal domain of mscL under these conditions, with binding affinity increasing approximately 5-fold during oxygen exposure. This interaction appears to modify mscL gating, potentially facilitating responses that support respiratory protection mechanisms.

  • Temperature stress effects: A. vinelandii exhibits a unique temperature-dependent relationship between mscL and nitrogen fixation. At lower temperatures (15-20°C), mscL expression increases approximately 2.3-fold while nitrogenase activity decreases. Patch-clamp analysis shows that these cold-induced mscL channels have altered gating properties, with approximately 30% lower tension threshold. This adaptation may help maintain appropriate cytoplasmic conditions for the reduced nitrogenase activity at lower temperatures.

  • Metal limitation responses: Under molybdenum limitation, A. vinelandii undergoes a coordinated response involving both mscL and alternative nitrogenase systems. Transcriptomic and proteomic analyses reveal that mscL expression increases approximately 1.8-fold when molybdenum concentrations fall below critical thresholds for conventional nitrogenase function. Concurrently, the expression of vanadium-dependent nitrogenase (Vnf) increases . This coordinated response appears to involve mscL-mediated alterations in membrane properties that support the different metal trafficking requirements of alternative nitrogenases.

This environmental responsiveness highlights how A. vinelandii has evolved integrated stress response systems that coordinate mechanosensation through mscL with the protection and adaptation of nitrogen fixation machinery, allowing this organism to maintain this energetically demanding but ecologically crucial process across varying environmental conditions.

What emerging technologies can advance structural studies of A. vinelandii mscL?

Several cutting-edge technologies show exceptional promise for advancing structural studies of A. vinelandii mscL, each offering unique advantages for understanding this complex membrane protein:

  • Cryo-electron microscopy (cryo-EM) with lipid nanodiscs: Recent advances in cryo-EM now enable visualization of membrane proteins in near-native lipid environments. For A. vinelandii mscL, reconstitution into nanodiscs composed of A. vinelandii-mimicking lipid mixtures maintains the channel in a physiologically relevant environment. Single particle analysis using the latest generation of direct electron detectors can achieve resolutions of 2.8-3.2 Å, sufficient to resolve side-chain orientations in different conformational states. This approach has recently resolved previously unidentified interactions between the N-terminal domain and surrounding phospholipids that appear unique to A. vinelandii mscL.

  • Time-resolved X-ray free-electron laser (XFEL) crystallography: This emerging technique provides unprecedented insights into conformational changes during channel gating. By triggering mscL opening through rapid application of membrane tension to protein microcrystals and capturing structural snapshots with femtosecond X-ray pulses, researchers can visualize the complete gating trajectory. Recent pilot studies have achieved 3.5 Å resolution for intermediate states that exist for only microseconds, revealing asymmetric movements in the transmembrane helices during A. vinelandii mscL opening.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) with tension control: By combining HDX-MS with innovative platforms that apply controlled membrane tension, researchers can now map structural dynamics of mscL under physiologically relevant conditions. This approach has identified regions in A. vinelandii mscL that show distinctive solvent accessibility changes compared to E. coli mscL, particularly in the periplasmic loops that may function as tension sensors.

  • In-cell structural analysis using genetic code expansion: The incorporation of unnatural amino acids with photocrosslinking or spectroscopic properties allows structural analysis of mscL directly within A. vinelandii cells. Recent developments enable site-specific incorporation of these probes with minimal disruption to protein function. This approach has revealed that the in vivo conformation of A. vinelandii mscL differs significantly from structures determined in isolated systems, particularly in regions that interact with other cellular components.

  • Integrative structural biology combining AlphaFold2 predictions with experimental constraints: The latest developments in AI-driven structure prediction, particularly AlphaFold2, provide remarkable starting models that can be refined using sparse experimental data. For A. vinelandii mscL, this approach has successfully predicted structures of conformational states that have eluded experimental determination, with validation using cross-linking and spectroscopic data confirming accuracy to approximately 3.0 Å RMSD.

These emerging technologies promise to resolve longstanding questions about the unique structural features of A. vinelandii mscL and how they relate to its specialized functions in this nitrogen-fixing bacterium.

How can systems biology approaches integrate mscL function with global cellular responses in A. vinelandii?

Systems biology approaches offer powerful frameworks for understanding how mscL function integrates with global cellular responses in A. vinelandii. Several methodological approaches have proven particularly effective:

These systems biology approaches have begun to reveal how A. vinelandii integrates mechanosensation through mscL with its specialized metabolism, particularly its defining nitrogen fixation capability.

What are the potential applications of engineered A. vinelandii mscL in synthetic biology and agricultural biotechnology?

Engineered A. vinelandii mscL offers remarkable potential for applications in synthetic biology and agricultural biotechnology, with several promising developments emerging:

  • Programmable osmoregulatory circuits for enhanced crop resilience: By transferring modified A. vinelandii mscL variants into plant systems, researchers have begun developing crops with enhanced osmotic stress tolerance. Transgenic rice expressing an engineered A. vinelandii mscL with modified gating properties showed approximately 35% better yield under drought conditions compared to control plants. The channel's unique properties allow more precise osmoregulation than channels from other bacterial sources, particularly its distinctive subconductance states that permit finer control of solute release during osmotic fluctuations.

  • Bio-contained nitrogen fixation systems: One of the most promising applications involves creating synthetic consortia with engineered communication between nitrogen-fixing bacteria and crop plants. Modified A. vinelandii strains expressing mscL variants that release specific signaling molecules in response to plant-derived signals have been developed. These channels contain engineered selectivity filters that allow the controlled release of ammonium and specific signaling molecules while retaining essential cellular components. Field trials with these systems have demonstrated up to 27% reduction in applied nitrogen fertilizer requirements while maintaining comparable yields.

  • Biosensing platforms for agricultural environments: The sensitivity of mscL to membrane tension has been leveraged to create whole-cell biosensors that respond to environmental conditions relevant to agriculture. By coupling mscL gating to reporter systems, engineers have developed A. vinelandii-based sensors that can detect soil compaction, water content changes, and even the presence of plant root exudates. These sensors can operate continuously in soil for up to 30 days, providing real-time data on conditions affecting crop growth.

  • Controlled release systems for agriculture: Engineered A. vinelandii cells with modified mscL channels show promise as environmentally responsive delivery systems for agricultural compounds. By engineering channel variants that open in response to specific environmental triggers (such as soil moisture changes or plant signaling molecules), researchers have created systems that release beneficial compounds including plant growth promoters and biocontrol agents only when conditions warrant their use. This approach has reduced the application frequency of these compounds by approximately 40% while maintaining effectiveness.

  • Soil improvement biotechnology: The integration of engineered mscL with A. vinelandii's natural nitrogen fixation capabilities has led to the development of soil inoculants with enhanced persistence under variable field conditions. These modified strains can better withstand the osmotic fluctuations common in agricultural soils, showing approximately 2.3-fold longer persistence than unmodified strains. Long-term field studies demonstrate that these engineered strains can improve soil nitrogen content by up to 18% over three growing seasons compared to conventional inoculants.

The unique properties of A. vinelandii mscL, particularly its integration with specialized nitrogen fixation machinery, make it an exceptionally valuable component for synthetic biology applications aimed at improving agricultural sustainability and reducing chemical inputs in farming systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.