Recombinant Azotobacter vinelandii Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill them accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please contact us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
yidC; Avin_52450; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-557
Protein Length
full length protein
Species
Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Target Names
yidC
Target Protein Sequence
MDIKRSILLVALAVVSYLLVLQWNQDYGQAALPPQNAVAQSASPALPETVPGDSSTSADV PTAGSGNQVPDSAASTAGSDLIQVRTDVLEVAIDPRGGDIVQLKLPKFPRRQDHPEIPFQ LFDNGSERLYLAQSGLTGTNGPDARADGRPLYVSEQRSYQLADGQDSLVVDLKFSDGGVD YVKRFTFKRGAYDLEVRHQIANHSEQPWSGNLFAQLKRDASADPSSTTATGTATYLGAAL WTSEEPYRKVSMGDMDDKNLRETVQGGWVAWLQHYFVTAWVPNKDDTNLVATRKDSQGNY IIGFTGSTLNIPAGATGETVTRLYAGPKDQNQLEALSPGLELTVDYGFLWFIAQPIFWLL ELIHALLGNWGWSIIVLTVIIKLAFFPLSAASYRSMGRMRAVAPKLQALKEQHGEDRQKL SQAMMELYKKEKINPLGGCLPILVQMPVFLALYWVLLESVEMRQAPWLGWITDLSVKDPY FILPIIMGATMFFQQTLNPTPPDPMQARVMKLMPIIFTFFFLWFPAGLVLYWVVNNVLSI GQQWYITRQIEKAAQLA
Uniprot No.

Target Background

Function
Essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Aids in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural and functional significance of YidC in bacterial membranes?

YidC is an essential membrane insertase belonging to the Oxa1 superfamily that facilitates the biogenesis of bacterial inner membrane proteins. It contains multiple transmembrane segments with a hydrophobic slide composed primarily of TM3 and TM5 serving as the major substrate contact site . Functionally, YidC operates through dual mechanisms:

  • As a membrane insertase, working both independently and in conjunction with the Sec translocon

  • As a lipid scramblase, contributing to membrane bilayer organization and lipid distribution

YidC significantly influences membrane protein composition through its insertase activity while simultaneously affecting lipid organization. This dual functionality makes YidC a central player in membrane homeostasis and protein targeting .

What experimental methods are most effective for studying YidC-substrate interactions?

Several complementary approaches have proven valuable for investigating YidC-substrate interactions:

In vivo approaches:

  • Translocation assays using radiolabeled pulse-chase experiments (1-minute pulse with 35S-methionine followed by TCA precipitation)

  • In vivo disulfide cross-linking between cysteine variants of YidC and potential interaction partners

  • Proximity-dependent biotin labeling (BioID) using YidC fused to mutant biotin ligase BirA*

  • SILAC-based affinity pulldown experiments for detecting native interactions

Protein detection and analysis methods:

  • Immunoprecipitation with YidC-specific antibodies

  • SDS-PAGE and phosphor imaging for visualizing radiolabeled proteins

  • Mass spectrometry (LC-MS/MS) for protein identification in complex samples

For example, BioID experiments have successfully identified YibN as a significant interactor of YidC, with validation through reciprocal affinity pulldown experiments that confirmed the physical association between these proteins under native expression conditions .

How does the YidC 5S mutant affect membrane protein insertion?

The YidC 5S mutant contains five serine substitutions at residues 430, 435, 468, 505, and 509 within the hydrophobic slide region. This mutant displays substrate-specific effects:

  • Growth phenotype: The 5S mutant fails to complement YidC depletion in E. coli strain MK6, resulting in growth defects when the chromosomal YidC is depleted

  • Substrate-specific effects: Surprisingly, the 5S mutant retains the ability to efficiently insert YidC-dependent substrates like M13 procoat, despite its inability to support cell growth

  • Sec-dependent insertion: The mutant appears specifically defective in Sec-dependent membrane insertion while maintaining capability for YidC-only substrate insertion

This suggests that YidC's essential function may relate more to its Sec-dependent activities than to its independent insertase function for substrates like M13 procoat, highlighting the complex and multifaceted nature of YidC function in membrane protein biogenesis.

What methods can be used to express and purify recombinant YidC for structural and functional studies?

Expression and purification of recombinant YidC requires specialized approaches for membrane proteins:

Expression strategies:

  • For E. coli YidC: Transform expression plasmids (pGZ119EH derivatives) into specialized strains like MK6 with arabinose-inducible chromosomal YidC

  • Induction conditions: Typically 1mM IPTG for plasmid-derived expression

  • Growth monitoring: Track OD600 to ensure consistent cell density (typically 0.4-0.5) before induction

Purification workflow:

  • Membrane isolation following cell disruption

  • Solubilization with appropriate detergents (1% DDM has been successful)

  • Affinity purification using tags (His-tags are commonly employed)

  • Optional secondary purification by size exclusion chromatography

  • Quality control by SDS-PAGE and functional assays

For Azotobacter vinelandii YidC specifically:
While direct methods for A. vinelandii YidC are not specified in the search results, the protocols established for E. coli YidC could be adapted, considering that both are gram-negative bacteria with similar membrane composition.

How does YibN enhance YidC-mediated membrane protein insertion?

YibN has been identified as a bona fide interactor of YidC with significant effects on membrane protein insertion:

Interaction evidence:

  • BioID experiments consistently identify YibN with the highest spectral counts among YidC interactors

  • Affinity pulldown experiments confirm direct physical association with >20-fold enrichment over background

  • Reciprocal pulldowns validate this interaction under native expression conditions

Functional impact on YidC substrates:
YibN significantly enhances the biogenesis of several YidC substrates as demonstrated in co-expression studies:

SubstrateEffect with YibN co-expressionYidC dependency
M13 procoat-LepSignificantly increased synthesisYidC-dependent
Pf3-23LepSignificantly increased synthesisYidC-dependent
F0c (ATP synthase subunit c)Significantly increased synthesisYidC-dependent
SecGSignificantly increased synthesisPotentially YidC-dependent
SecG I20E mutantReduced enhancement effectHydrophobicity dependent
YajCNo significant effectYidC-independent
YhcBNo significant effectYidC-independent

Notably, the enhancement effect appears to be substrate-specific and potentially related to the hydrophobicity of transmembrane segments, as demonstrated by the reduced effect on the SecG I20E mutant compared to wild-type SecG .

What approaches can distinguish between Sec-dependent and Sec-independent YidC functions?

Distinguishing between these pathways requires specialized experimental designs:

Genetic approaches:

  • YidC depletion studies using strains like MK6 with arabinose-inducible chromosomal YidC

  • Complementation assays with YidC variants (e.g., the 5S mutant) that differentially affect Sec-dependent versus independent functions

  • Analysis of growth phenotypes under depletion conditions with various complementing constructs

Biochemical assays:

  • In vivo disulfide cross-linking between cysteine variants of SecY and YidC to map interaction sites

  • Substrate translocation assays using radiolabeled pulse-chase experiments to monitor insertion efficiency

  • Immunoprecipitation with substrate-specific antibodies to detect properly inserted products

Substrate selection strategy:
Select model substrates with known insertion pathways for comparative analysis:

  • M13 procoat as a YidC-only substrate

  • Pf3 coat protein as a YidC-only substrate

  • F0c as a YidC-dependent substrate

  • SecG with variable YidC-dependency

Results from these approaches have demonstrated that YidC mutants can differentially impact Sec-dependent versus independent functions, as observed with the 5S mutant that maintained M13 procoat insertion capability despite losing essential cellular function .

How does the hydrophobic slide of YidC contribute to substrate recognition and insertion?

The hydrophobic slide of YidC constitutes the major substrate contact site and plays a critical role in membrane protein insertion:

Structural components:

  • Primarily composed of transmembrane segments TM3 and TM5

  • Key residues in positions 430, 435, 468, 505, and 509 (targeted in the 5S mutant)

  • Forms a region that facilitates the lateral release of transmembrane segments into the lipid bilayer

Functional significance:

  • Systematic mutagenesis of the hydrophobic slide residues affects YidC function

  • The 5S mutant with five serine substitutions in the hydrophobic region exhibits substrate-specific defects

  • Different residues within the slide appear important for different substrates, suggesting a complex recognition mechanism

Experimental approaches for studying the hydrophobic slide:

  • Alanine or serine scanning mutagenesis of transmembrane regions

  • Substrate insertion assays with YidC variants containing slide mutations

  • Disulfide cross-linking to map substrate contact points within the slide region

The hydrophobic slide appears to be particularly important for SecYEG interaction, as mutations in this region (like the 5S mutant) specifically impair Sec-dependent functions while preserving independent insertase activity for substrates like M13 procoat .

What are the key considerations for in vivo disulfide cross-linking studies with YidC?

Disulfide cross-linking is a powerful technique for identifying molecular interactions between YidC and other proteins:

Experimental protocol overview:

  • Generate single cysteine mutants of YidC and potential interaction partners (e.g., SecY)

  • Co-transform plasmids carrying the mutated genes into appropriate strains (e.g., MK6)

  • Grow cultures under YidC depletion conditions (glucose medium, OD600 0.4-0.5)

  • Induce protein expression (typically 1mM IPTG for 20 minutes)

  • Pulse-label with 35S-methionine (3 minutes)

  • Oxidize with 200μM DTNB for 10 minutes to catalyze disulfide bond formation

  • Process samples for immunoprecipitation with appropriate antibodies

  • Analyze results by SDS-PAGE under reducing and non-reducing conditions

Critical parameters:

  • Rigorous controls including non-cysteine variants and reducing/non-reducing conditions

  • Careful selection of cysteine substitution positions based on structural predictions

  • Optimization of oxidation conditions to maximize specific cross-linking

  • Thorough washing steps to minimize non-specific binding during immunoprecipitation

This approach has successfully demonstrated specific interactions between YidC and components of the Sec translocon, confirming their physical proximity in the membrane .

How can researchers optimize proximity-dependent biotin labeling (BioID) for studying YidC interactions?

BioID has emerged as a valuable tool for identifying proteins in the vicinity of YidC:

Implementation strategy:

  • Generate fusion constructs with YidC-BirA* (using the BirA R118G mutant)

  • Express the fusion protein using appropriate control (comparison with non-mutant BirA is essential)

  • Isolate bacterial inner membrane and solubilize with 1% DDM

  • Capture biotinylated proteins using NeutrAvidin beads

  • Analyze by Western blot to confirm biotinylation and by LC-MS/MS for protein identification

Data analysis considerations:

  • Rank proteins based on spectral counts across multiple replicates

  • Focus on proteins consistently detected across independent experiments

  • Validate top candidates through complementary approaches like affinity pulldown

This approach successfully identified YibN as a significant YidC interactor, which was subsequently confirmed through multiple validation techniques, demonstrating the power of BioID for discovering novel membrane protein interactions .

What techniques can assess the functional impact of YidC on substrate insertion efficiency?

Several complementary approaches can quantify YidC's effect on substrate insertion:

Co-expression studies:

  • Transform cells with plasmids encoding YidC (or variants) and substrate proteins

  • Induce expression (typically 0.1% arabinose for YidC, 0.75mM IPTG for substrates)

  • Collect samples at various timepoints (15-minute intervals recommended)

  • Analyze by SDS-PAGE and Western blot with substrate-specific antibodies

  • Quantify substrate accumulation relative to control conditions

Pulse-chase analysis:

  • Express YidC variants in appropriate strains (e.g., MK6)

  • Pulse-label with 35S-methionine (typically 1-3 minutes)

  • Chase with excess unlabeled methionine if monitoring processing events

  • Immunoprecipitate the substrate of interest

  • Analyze by SDS-PAGE and phosphor imaging

Controls and considerations:

These approaches have revealed that YibN significantly enhances the biogenesis of several YidC substrates, including M13 procoat-Lep, Pf3-23Lep, F0c, and SecG, but not YidC-independent proteins like YajC and YhcB .

What are the limitations in current understanding of YidC's mechanism of action?

Despite extensive research, several aspects of YidC function remain incompletely understood:

Mechanistic uncertainties:

  • The precise energetics driving YidC-mediated insertion

  • How substrate recognition occurs at the molecular level

  • The coordination between YidC's insertase and scramblase activities

  • The complete set of YidC interactors and their functional significance

Technical challenges:

  • Capturing transient intermediates during the insertion process

  • Obtaining high-resolution structures of YidC-substrate complexes

  • Developing real-time assays for monitoring insertion kinetics

  • Reconstituting complex multi-component systems in vitro

The recent identification of YibN as a significant YidC interactor provides new research directions, as YibN appears to enhance YidC-mediated protein insertion and potentially influence its lipid scramblase activity . Understanding this interaction may help address some of the current mechanistic uncertainties.

How might research on A. vinelandii YidC contribute to understanding membrane protein insertion?

While the search results don't provide direct information about A. vinelandii YidC specifically, this organism offers potential advantages for membrane protein research:

Potential research opportunities:

  • A. vinelandii is a free-living nitrogen-fixing bacterium with unique metabolic capabilities

  • Its demonstrated ability to degrade environmental contaminants like chlorpyrifos suggests robust membrane transport systems

  • As a soil bacterium, A. vinelandii may have evolved specialized membrane adaptations that could inform YidC function in diverse environments

Methodological approaches:

  • Comparative genomic analysis of YidC sequences across bacterial species including A. vinelandii

  • Heterologous expression of A. vinelandii YidC in E. coli systems

  • Functional complementation studies to assess interchangeability of YidC homologs

  • Investigation of YidC's role in membrane protein insertion under nitrogen-fixing conditions

Given A. vinelandii's established research applications in bioremediation , studying its membrane protein insertion machinery, including YidC, could provide insights into membrane protein biogenesis under environmentally relevant conditions.

What emerging technologies might advance YidC research in the coming years?

Several cutting-edge approaches hold promise for addressing current research challenges:

Advanced structural methods:

  • Cryo-electron tomography for visualizing YidC in its native membrane environment

  • Integrative structural biology combining multiple data sources (X-ray, NMR, EM, cross-linking) for comprehensive models

  • Single-particle cryo-EM of YidC-substrate complexes at various insertion stages

Functional genomics approaches:

  • CRISPR-based screening to identify genetic interactions with YidC

  • Deep mutational scanning to comprehensively map structure-function relationships

  • Ribosome profiling to monitor co-translational insertion events mediated by YidC

Biophysical techniques:

  • Single-molecule FRET to track conformational changes during insertion

  • Mass photometry for studying YidC oligomerization states

  • Native mass spectrometry for characterizing intact membrane protein complexes

  • Advanced fluorescence microscopy to visualize YidC dynamics in living cells

These emerging technologies could help resolve the remaining questions about YidC's mechanism of action, its interactions with proteins like YibN, and its dual role in protein insertion and lipid organization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.