Recombinant Azotobacter vinelandii Na (+)-translocating NADH-quinone reductase subunit E

Shipped with Ice Packs
In Stock

Description

Functional Role in the Na⁺-NQR Complex

Subunit E is part of the Na⁺-translocating NADH-quinone reductase (Na⁺-NQR), a membrane-bound enzyme critical for generating sodium motive force (SMF) in bacteria. In Azotobacter vinelandii, Na⁺-NQR activity is essential for maintaining transmembrane Na⁺ gradients, which regulate secondary transport processes and biofilm formation .

Key Functions:

  • Sodium Translocation: Couples NADH oxidation to Na⁺ transport, generating a SMF for ATP synthesis and solute uptake.

  • Iron-Sulfur Cluster Assembly: Subunits NqrD and NqrE coordinate an Fe center in the membrane domain, enabling redox-driven Na⁺ pumping .

  • Regulation of Alginate Production: Loss of Na⁺-NQR activity (e.g., via nqrE disruption) leads to alginate overproduction, suggesting a link between Na⁺ gradients and exopolysaccharide biosynthesis .

Impact of nqrE Disruption in A. vinelandii

A transposon insertion in nqrE (strain GG4) abolished Na⁺-NQR activity and increased alginate production. Complementation with nqrEF restored activity and reduced alginate levels, confirming subunit E’s role in maintaining Na⁺ gradients .

StrainNa⁺-NQR ActivityAlginate Production
Wild-typeActiveBasal levels
nqrE::Tn5 (GG4)Absent2–3× elevated
GG4 + nqrEFRestoredBasal levels

Biotechnological Relevance

The recombinant subunit E is used to study:

  • NQR Assembly: Maturation requires flavin transferase (ApbE) and Fe-delivery proteins (e.g., NqrM in other species), though A. vinelandii’s dependence on these factors remains uncharacterized .

  • Biofilm Engineering: Manipulating Na⁺-NQR activity could modulate alginate production in biotechnological applications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its implementation.
Synonyms
nqrE; Avin_14630; Na(+-translocating NADH-quinone reductase subunit E; Na(+-NQR subunit E; Na(+-translocating NQR subunit E; NQR complex subunit E; NQR-1 subunit E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Target Names
nqrE
Target Protein Sequence
MEHYISLFVKSVFIENMALAFFLGMCTFIAISKKVETAIGLGIAVVVVQAITVPANNLLY AYLLKEGALAWAGLPDIDLSFLGFLSYIGVIAAIVQILEMLLDKYVPSLYNALGIYLPLI TVNCAIMAGSLFMVERDYNFPESVVYGIGSGFSWALAIALLAGIREKLKYSDVPEGLQGL GIAFITIGLMSLGFMSFSGIQL
Uniprot No.

Target Background

Function

The NQR complex catalyzes the two-step reduction of ubiquinone-1 to ubiquinol, coupled with the translocation of Na+ ions from the cytoplasm to the periplasm. NqrA through NqrE are likely involved in the second step, converting ubisemiquinone to ubiquinol.

Database Links
Protein Families
NqrDE/RnfAE family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Na(+)-translocating NADH-quinone reductase in Azotobacter vinelandii?

Na(+)-translocating NADH-quinone reductase (Na+-NQR) in A. vinelandii is a respiratory enzyme complex that catalyzes the oxidation of NADH and reduction of ubiquinone while simultaneously pumping sodium ions across the cytoplasmic membrane. This enzyme serves as the main sodium pump under conditions of approximately 2 mM Na+ concentration and plays a crucial role in regulating alginate synthesis, an exopolysaccharide produced by this nitrogen-fixing bacterium . Unlike conventional proton-pumping NADH dehydrogenases, Na+-NQR specifically translocates sodium ions, contributing to the establishment of a transmembrane Na+ gradient that influences various cellular processes in A. vinelandii.

What is the relationship between Na+-NQR activity and alginate production?

A clear inverse relationship exists between Na+-NQR activity and alginate synthesis in A. vinelandii. Studies have shown that disruption of the nqrE gene results in significant alginate overproduction . When Na+-NQR activity is abolished in mutant strains like GG4 (nqrE::Tn5), alginate production increases substantially. Conversely, when these mutants are complemented with nqrEF genes and Na+-NQR activity is restored, alginate production returns to wild-type levels . This relationship appears to be mediated through the transmembrane Na+ gradient, as the absence of Na+-NQR activity causes the absence of this gradient, which subsequently triggers increased alginate synthesis. This regulatory mechanism may represent an adaptive response in A. vinelandii, potentially linking metabolic state with exopolysaccharide production that protects the organism from environmental stresses.

What methods are used to assess Na+-NQR activity in recombinant systems?

Several methodologies can be employed to measure Na+-NQR activity in recombinant systems:

  • Spectrophotometric assays: Na+-NQR activity can be monitored by measuring the oxidation rate of NADH spectrophotometrically at 340 nm in the presence of appropriate electron acceptors such as ubiquinone or ubiquinone analogs .

  • Oxygen consumption assays: Since Na+-NQR feeds electrons into the respiratory chain, oxygen consumption rates can be measured using oxygen electrodes in membrane preparations or whole cells expressing recombinant Na+-NQR components.

  • Na+ transport measurements: Radioactive 22Na+ uptake or efflux studies can directly measure the sodium translocation activity of the enzyme.

  • Inhibitor sensitivity assays: Specific inhibitors like 2-n-heptyl-4-hydroxyquinoline N-oxide (HQNO) can be used to distinguish Na+-NQR activity from other NADH dehydrogenases .

These methods often require careful preparation of membrane fractions or proteoliposomes with incorporated recombinant Na+-NQR components to maintain the functional integrity of the complex.

What expression systems are suitable for producing recombinant nqrE?

The choice of expression system for recombinant nqrE production depends on experimental requirements:

Expression SystemAdvantagesLimitationsApplications
E. coliHigh yields, simple cultivation, well-established protocolsMay lack proper membrane integration, potential protein misfoldingStructural studies, antibody production, protein interaction studies
Pseudomonas speciesCloser phylogenetic relationship to A. vinelandii, similar membrane compositionLower expression yields compared to E. coliFunctional studies requiring proper membrane integration
Homologous expression in A. vinelandiiNative environment ensures proper folding and assemblyComplex cultivation requirements, lower yieldsFunctional complementation studies, in vivo analysis
Cell-free systemsAvoids toxicity issues, allows rapid optimizationLower yields for membrane proteins, expensiveRapid screening of expression conditions

For functional studies, co-expression of multiple nqr subunits (especially nqrEF) is often necessary to achieve proper folding and assembly of the complex. Addition of chaperones and careful optimization of membrane fraction preparation protocols significantly improve the yield of functional recombinant protein .

How does the loss of Na+-NQR activity affect cellular bioenergetics and nitrogen fixation?

The absence of Na+-NQR activity substantially impacts A. vinelandii's bioenergetic landscape, with significant consequences for nitrogen fixation. When Na+-NQR function is disrupted through mutations in nqrE, the cell loses its primary mechanism for establishing a transmembrane sodium gradient . This disruption alters the cell's bioenergetic state in several important ways:

  • Altered respiratory electron flow: Without functional Na+-NQR, electron flow through the respiratory chain is redistributed to alternative NADH dehydrogenases, particularly the proton-pumping NDH-I and the non-coupled NDH-II complexes .

  • Reduced respiratory protection: The ability of A. vinelandii to protect its oxygen-sensitive nitrogenase through respiratory mechanisms may be compromised, as efficient electron flow through the respiratory chain is essential for this protective mechanism .

  • Compensatory metabolic responses: The cell likely upregulates alternative respiratory pathways to compensate for the loss of Na+-NQR activity, potentially including increased expression of cytochrome oxidases.

These bioenergetic alterations significantly impact nitrogen fixation, as A. vinelandii must maintain a delicate balance between aerobic respiration and protection of its oxygen-sensitive nitrogenase complex. Research indicates that A. vinelandii employs multiple NADH:quinone oxidoreductases as a vital component of the respiratory protection mechanism for the nitrogenase complex . Therefore, disruptions to Na+-NQR activity likely necessitate metabolic adaptations to maintain effective nitrogen fixation under aerobic conditions.

What structural features of nqrE are essential for Na+ translocation?

The nqrE subunit contains several structural features that are critical for its function in Na+ translocation:

  • Transmembrane helices: nqrE is a hydrophobic membrane protein with multiple transmembrane domains that participate in forming the sodium channel within the Na+-NQR complex .

  • Conserved cysteine residues: Similar to other Na+-NQR complexes, the A. vinelandii nqrE likely contains strictly conserved cysteine residues within its transmembrane helices that are essential for proper folding and stability of the complex . Research on Na+-NQR from Vibrio harveyi has shown that substitutions of these conserved cysteine residues block the Na+-dependent quinone reductase activity of the enzyme .

  • Ion coordination sites: Specific amino acid residues within nqrE likely contribute to forming coordination sites for Na+ ions during the translocation process.

  • Interaction interfaces: Regions of nqrE that interface with other subunits, particularly nqrF, are crucial for assembling a functional complex, as demonstrated by complementation studies showing that both nqrE and nqrF are required to restore function in mutant strains .

These structural elements work in concert to enable the coupling of electron transfer from NADH to ubiquinone with the translocation of Na+ ions across the membrane, a process that is central to the function of the Na+-NQR complex.

What methodological approaches can be used to study the relationship between Na+-NQR and alginate production?

Several sophisticated methodological approaches can be employed to investigate the relationship between Na+-NQR activity and alginate synthesis:

  • Conditional expression systems: Developing strains with inducible nqrE expression allows for controlled modulation of Na+-NQR activity and observation of resulting changes in alginate production. This approach enables time-course studies of how alginate synthesis responds to altered Na+-NQR function.

  • Transcriptomic analysis: RNA-sequencing comparing wild-type A. vinelandii with nqrE mutants can identify changes in expression of genes involved in alginate biosynthesis and regulation, revealing potential signaling pathways connecting Na+-NQR activity to alginate production.

  • Sodium gradient measurements: Fluorescent sodium indicators or sodium-sensitive electrodes can be used to quantify transmembrane Na+ gradients in wild-type versus nqrE mutant strains, correlating gradient strength with alginate synthesis rates.

  • Metabolic flux analysis: Isotope-labeled precursors can track carbon flow through central metabolism and into alginate biosynthesis pathways in strains with varying Na+-NQR activity, identifying metabolic branch points affected by Na+-NQR function.

  • Phosphoproteomics: Analysis of protein phosphorylation patterns may reveal signaling cascades that connect Na+-NQR activity to the regulation of alginate biosynthesis enzymes.

  • Site-directed mutagenesis: Creating point mutations in nqrE that partially affect Na+-NQR function rather than completely abolishing it can help establish a dose-response relationship between Na+-NQR activity and alginate production levels.

These approaches collectively provide a comprehensive understanding of how Na+-NQR activity influences alginate synthesis at molecular, cellular, and physiological levels.

How can recombinant nqrE be used for structure-function relationship studies?

Recombinant nqrE provides a powerful tool for elucidating structure-function relationships within the Na+-NQR complex through several sophisticated experimental approaches:

  • Site-directed mutagenesis: Systematic alteration of conserved residues in recombinant nqrE can identify amino acids critical for Na+ translocation, complex assembly, or ubiquinone binding. Each mutant can be assessed for its ability to:

    • Restore Na+-NQR activity in complementation studies

    • Properly assemble into the Na+-NQR complex

    • Support Na+ translocation

    • Maintain proper ubiquinone reduction kinetics

  • Protein-protein interaction studies: Techniques such as chemical cross-linking, co-immunoprecipitation, or two-hybrid systems using recombinant nqrE variants can map interaction interfaces with other Na+-NQR subunits, particularly nqrF, which appears to function closely with nqrE .

  • Domain swapping experiments: Creating chimeric proteins by swapping domains between nqrE from different bacterial species can identify regions responsible for species-specific functional characteristics or substrate preferences.

  • Biophysical characterization: Purified recombinant nqrE can be subjected to structural analysis using techniques such as:

    • X-ray crystallography or cryo-electron microscopy for high-resolution structural determination

    • Circular dichroism spectroscopy to assess secondary structure

    • Fluorescence spectroscopy to examine conformational changes during substrate binding or catalysis

  • Reconstitution experiments: Incorporating recombinant nqrE into proteoliposomes with other Na+-NQR subunits allows for controlled assessment of transport activity and electron transfer functions in a defined membrane environment.

What role does Na+-NQR play in respiratory protection of nitrogenase?

The role of Na+-NQR in respiratory protection of nitrogenase in A. vinelandii represents a fascinating aspect of how this bacterium maintains nitrogen fixation under aerobic conditions:

  • Respiratory electron sink: A. vinelandii employs a respiratory protection mechanism whereby high rates of oxygen consumption through respiratory chains help maintain low intracellular oxygen concentrations around the oxygen-sensitive nitrogenase complex . Na+-NQR likely contributes to this process by providing an alternative pathway for NADH oxidation, particularly under high oxygen conditions.

  • Coordination with other respiratory enzymes: A. vinelandii possesses multiple respiratory NADH dehydrogenases, including the proton-pumping NDH-I and the non-coupled NDH-II. Research indicates that NDH-II expression is induced under high oxygen conditions and during diazotrophic growth, suggesting a specialized role in respiratory protection . The relationship between Na+-NQR and these alternative NADH dehydrogenases is likely important for optimizing respiratory protection under different conditions.

  • Energy conservation during oxygen-intensive respiration: While uncoupled respiration through NDH-II provides effective oxygen consumption without energy conservation, Na+-NQR offers an alternative that contributes to establishing an ion gradient that can be utilized for ATP synthesis, potentially helping balance the high energetic demands of nitrogen fixation with the need for respiratory protection.

  • Regulatory connections: The expression of respiratory chain components in A. vinelandii, including cytochrome bd oxidase, is regulated by CydR (homologous to FNR in E. coli) in response to oxygen availability . The potential co-regulation of Na+-NQR with other components of respiratory protection systems suggests integration into a coordinated response to oxygen stress during nitrogen fixation.

Experimental evidence from NDH-II-deficient strains shows they are unable to grow diazotrophically at high aeration but can grow at low aeration or with fixed nitrogen sources, highlighting the critical nature of respiratory chain composition for nitrogen fixation under aerobic conditions . Similar studies with Na+-NQR deficient strains would further clarify its specific contribution to respiratory protection.

How can quinone binding and electron transfer be studied in recombinant Na+-NQR complexes?

Investigating quinone binding and electron transfer in recombinant Na+-NQR complexes requires sophisticated biochemical and biophysical approaches:

  • Quinone binding studies:

    • Isothermal titration calorimetry (ITC) can quantify binding affinities and thermodynamic parameters of quinone interaction with purified recombinant Na+-NQR complexes

    • Saturation transfer difference NMR spectroscopy can identify specific protein-quinone interactions, as demonstrated with Na+-NQR from Vibrio cholerae where two quinone analog ligands were found to bind simultaneously to the NqrA subunit

    • Tryptophan fluorescence quenching provides another method to detect and quantify quinone binding

  • Electron transfer kinetics:

    • Stopped-flow spectroscopy can measure rates of electron transfer from NADH to various electron acceptors, including ubiquinone and analogs

    • Rapid freeze-quench EPR spectroscopy allows identification of intermediate states during electron transfer through the complex

    • Pre-steady-state kinetics can delineate the sequence of electron transfer events within the complex

  • Inhibitor studies:

    • Compounds like 2,5-dibromo-3-methyl-6-isopropyl-p-benzoquinone (DBMIB) and 2-n-heptyl-4-hydroxyquinoline N-oxide (HQNO) inhibit Na+-NQR and can be used to probe quinone binding sites

    • Competitive binding assays with these inhibitors can identify key residues involved in quinone interaction

  • Double occupancy quinone binding model:

    • Research with Na+-NQR from Vibrio cholerae has revealed a unique double occupancy of quinone-type ligands in the catalytic quinone binding site

    • Similar experiments with recombinant A. vinelandii Na+-NQR could determine if this mechanism is conserved and involves nqrE

  • Site-directed spin labeling:

    • Strategic introduction of spin labels coupled with EPR spectroscopy can map conformational changes associated with quinone binding and electron transfer

These methodological approaches provide comprehensive insights into the mechanisms of quinone binding and electron transfer in recombinant Na+-NQR complexes, particularly how the nqrE subunit contributes to these functions.

What are common challenges in expressing functional recombinant nqrE?

Researchers frequently encounter several challenges when attempting to express functional recombinant nqrE:

  • Membrane protein solubility issues: As an integral membrane protein, nqrE can aggregate or misfold during expression, particularly in heterologous systems. This often manifests as inclusion body formation in E. coli expression systems, requiring optimization of:

    • Induction conditions (temperature, inducer concentration, culture density)

    • Host strain selection (C41/C43 strains designed for membrane protein expression)

    • Fusion partners (solubility tags like MBP or SUMO)

    • Membrane-mimetic environments during purification

  • Complex assembly requirements: Functional nqrE likely requires interaction with other Na+-NQR subunits, particularly nqrF, as complementation studies show both are needed to restore activity in mutant strains . Strategies to address this include:

    • Co-expression of multiple subunits (especially nqrEF)

    • Sequential purification approaches that maintain subunit interactions

    • In vitro reconstitution of subunit complexes

  • Cofactor incorporation: Ensuring proper incorporation of any essential cofactors or prosthetic groups, which may include iron-sulfur clusters similar to those found in Na+-NQR of Vibrio harveyi .

  • Post-translational modifications: Any required post-translational modifications may not occur correctly in heterologous expression systems, necessitating:

    • Expression in more closely related bacterial hosts

    • Supplementation of expression media with precursors for modifications

  • Toxicity to host cells: Overexpression of membrane proteins often stresses host cells, requiring:

    • Use of tightly regulated expression systems

    • Optimization of cell growth and induction timing

    • Consideration of cell-free expression systems for particularly toxic proteins

Each of these challenges requires systematic optimization and may necessitate compromises between yield and functionality of the recombinant protein.

How can the activity of recombinant Na+-NQR be optimized in vitro?

Optimizing the activity of recombinant Na+-NQR in vitro requires careful attention to several factors:

FactorOptimization ApproachImpact on Activity
Membrane environmentSelection of appropriate detergents or lipid compositions for purification and assaysCritical for maintaining native protein conformation and activity
Buffer compositionOptimization of pH, ionic strength, and specific ion concentrations (especially Na+)Na+-NQR activity is Na+-dependent and pH-sensitive
Cofactor supplementationAddition of flavins, iron, and other potential cofactors during purification or assayEnsures all prosthetic groups are present for electron transfer
Reducing environmentInclusion of appropriate reducing agents to maintain cysteine residues in their proper redox statePreserves structural integrity and function of the complex
Substrate concentrationTitration of NADH and quinone concentrationsDetermines reaction kinetics and prevents substrate inhibition
TemperatureDetermination of optimal temperature for activity versus stabilityBalances enzymatic activity with protein stability

Specific methodological approaches include:

  • Reconstitution into proteoliposomes with defined lipid composition to better mimic the native membrane environment

  • Sequential addition of purified subunits to optimize complex assembly

  • Activity assays in the presence of various osmoprotectants to stabilize the complex

  • Pre-incubation with potential activators or specific lipids before activity measurements

  • Development of coupled enzyme assays that may better reflect physiological conditions

These optimization strategies should be tailored to the specific experimental objectives, whether they focus on structural studies, kinetic analyses, or inhibitor screening.

How can researchers distinguish between Na+-NQR activity and other NADH dehydrogenases?

Distinguishing Na+-NQR activity from other NADH dehydrogenases, particularly NDH-I and NDH-II which are also present in A. vinelandii , requires specific experimental approaches:

  • Specific inhibitor sensitivity:

    • Na+-NQR is specifically inhibited by 2-n-heptyl-4-hydroxyquinoline N-oxide (HQNO)

    • DBMIB (2,5-dibromo-3-methyl-6-isopropyl-p-benzoquinone) inhibits Na+-NQR in a mixed inhibition mode

    • Measuring NADH oxidation rates in the presence and absence of these inhibitors can isolate Na+-NQR contribution

  • Sodium dependence:

    • Na+-NQR activity is Na+-dependent, while NDH-I and NDH-II activities are not

    • Assays conducted with varying Na+ concentrations can identify the Na+-dependent component of NADH oxidation

  • Substrate specificity:

    • NDH-II from A. vinelandii can oxidize both NADH and NADPH

    • Na+-NQR is generally more specific for NADH

    • Comparing oxidation rates with different substrates can help distinguish these activities

  • Energy coupling characteristics:

    • Na+-NQR activity is coupled to Na+ translocation

    • NDH-I is coupled to H+ translocation

    • NDH-II is noncoupled (does not contribute to ion gradients)

    • Measuring ion translocation in membrane vesicles or proteoliposomes can differentiate these activities

  • Genetic approaches:

    • Using defined mutant strains lacking specific NADH dehydrogenases

    • Complementation with recombinant nqrE in nqrE-deficient strains to confirm specificity of restored activity

    • Comparing activity profiles in wild-type versus mutant membranes

By combining these approaches, researchers can reliably attribute measured activities to specific NADH dehydrogenase types, enabling accurate characterization of recombinant Na+-NQR function.

What potential applications exist for engineered nqrE variants in biotechnology?

Engineered variants of nqrE from A. vinelandii offer several promising biotechnological applications:

  • Enhanced alginate production systems: Given that nqrE mutations lead to alginate overproduction , engineered nqrE variants could be used to develop strains with controlled alginate production for industrial applications. Alginate has numerous applications in the food, pharmaceutical, and biomedical industries, and optimized production systems are highly valuable.

  • Biosensors for sodium ions: Engineered Na+-NQR complexes incorporating modified nqrE subunits could serve as the basis for highly sensitive and specific biosensors for sodium ions in environmental or clinical samples. The natural sodium sensitivity of Na+-NQR makes it an excellent starting point for such applications.

  • Bioelectrochemical systems: Recombinant Na+-NQR components could be incorporated into electrode surfaces to create bioelectrochemical systems that couple NADH oxidation to electrical current generation. Such systems could have applications in biofuel cells or biosensing platforms.

  • Models for studying respiratory protection: Engineered nqrE variants could serve as valuable tools for understanding respiratory protection mechanisms in nitrogen-fixing bacteria , potentially leading to improved agricultural applications of biological nitrogen fixation.

  • Drug discovery platforms: Given the presence of Na+-NQR in various bacterial pathogens but not in humans, engineered Na+-NQR systems incorporating nqrE could serve as platforms for screening and developing antibacterial compounds targeting this enzyme complex.

These applications represent areas where fundamental research on nqrE structure and function could be translated into biotechnological innovations with significant industrial or clinical impact.

How might systems biology approaches enhance our understanding of Na+-NQR in cellular metabolism?

Systems biology approaches offer powerful frameworks for elucidating the complex roles of Na+-NQR in A. vinelandii metabolism:

  • Multi-omics integration: Combining transcriptomics, proteomics, and metabolomics data from wild-type and nqrE mutant strains under various growth conditions can reveal:

    • Comprehensive regulatory networks connecting Na+-NQR activity to alginate synthesis

    • Metabolic adaptations that compensate for Na+-NQR deficiency

    • Unexpected connections between sodium homeostasis and other cellular processes

  • Genome-scale metabolic modeling: Constraint-based metabolic models of A. vinelandii incorporating Na+-NQR function can:

    • Predict metabolic flux distributions under various conditions

    • Identify potential synthetic lethal interactions with nqrE mutations

    • Guide metabolic engineering efforts for optimized alginate production

  • Regulatory network reconstruction: Inference of gene regulatory networks from multi-omics data can identify:

    • Transcription factors responding to altered Na+ gradients

    • Regulatory links between respiratory chain components and alginate biosynthesis

    • Potential signaling pathways connecting Na+-NQR activity to gene expression changes

  • In silico evolution experiments: Computational approaches simulating the evolution of metabolic networks can provide insights into:

    • The evolutionary origins of Na+-NQR in A. vinelandii

    • Selective pressures that maintain Na+-NQR function in this organism

    • Potential alternative evolutionary solutions to the respiratory protection challenge

  • Flux balance analysis with respiratory chain constraints: Advanced metabolic modeling specifically incorporating electron transfer chain components can:

    • Predict optimal distributions of electron flow under various growth conditions

    • Identify conditions where Na+-NQR activity becomes particularly important

    • Guide experimental design for testing model predictions

These systems biology approaches provide a more holistic understanding of Na+-NQR function within the broader context of A. vinelandii metabolism, revealing emergent properties not apparent from reductionist approaches alone.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.