Recombinant Azotobacter vinelandii NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Electron Transport and Proton Translocation

The Nuo complex transfers electrons from NADH to ubiquinone, coupling this process to proton translocation across the membrane. In A. vinelandii, this activity is critical for maintaining the proton gradient required for ATP synthase. While the Ndh complex (NDH II) is involved in respiratory protection of nitrogenase under high oxygen conditions , the Nuo complex plays a central role in baseline energy metabolism .

Genomic Context

The nuoK gene is part of the nuo operon (Avin28440–Avin28560), encoding subunits of the NADH-quinone oxidoreductase. The genome of A. vinelandii DJ (strain) contains a single circular chromosome with 5,365,318 bp, including genes for oxygen-sensitive enzymes like nitrogenase and carbon monoxide dehydrogenase .

Recombinant Expression and Purification

The recombinant nuoK protein is expressed in E. coli and purified via affinity chromatography due to its His-tag. This system enables structural and functional studies of the Nuo complex. For example:

  • Structural Analysis: The His-tag facilitates crystallization for X-ray diffraction studies.

  • Functional Assays: The purified protein can be reconstituted into liposomes to study proton translocation or electron transfer kinetics .

Comparative Analysis with Other Complexes

ComplexCatalytic ActivityProton/Na⁺ TranslocationRole in A. vinelandii
NuoNADH → UbiquinoneProton pumpingATP production, aerobic respiration
NdhNADH → UbiquinoneNoneRespiratory protection of nitrogenase
NqrNADH → UbiquinoneNa⁺ translocationSodium gradient generation

The Nuo complex is distinguished by its ATP-coupled proton-pumping activity, unlike the uncoupled Ndh and Sha complexes .

Genetic and Biochemical Studies

  1. Genomic Deletions: Strains lacking nuo genes (e.g., Δnuo) show impaired growth under aerobic conditions due to reduced ATP synthesis .

  2. Interaction with Nitrogenase: The Nuo complex indirectly supports nitrogen fixation by maintaining cellular energy levels, though direct electron transfer to nitrogenase is mediated by other systems like the FixABCX complex .

  3. Regulation: Expression of Nuo is regulated by oxygen availability, with higher activity under aerobic conditions .

Biotechnological Relevance

The recombinant nuoK protein serves as a tool for studying:

  • Enzyme Mechanism: Electron bifurcation or proton-pumping pathways.

  • Drug Targeting: Inhibitors of NADH-quinone oxidoreductases for antimicrobial development.

  • Industrial Applications: Enhancing biofuel production via engineered redox pathways .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us, and we will prioritize the development of the specified tag.
Synonyms
nuoK; Avin_28530; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Target Names
nuoK
Target Protein Sequence
MNAIPMEHGLALSGVLFSLGLIGLMVRRNILFVLMSLEVMMNAAALAFVVAGSRWAQADG QIMFILVITLAAAEASIGLAILLQLHRRFHTLDIDAASEMRG
Uniprot No.

Target Background

Function
NDH-1 facilitates the transfer of electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be ubiquinone. This process couples the redox reaction to proton translocation, whereby four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred. This mechanism effectively conserves the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase in Azotobacter vinelandii and why is it significant?

NADH-quinone oxidoreductase in Azotobacter vinelandii exists in two distinct forms: a proton-pumping complex (NDH I) and a non-proton-pumping form (NDH II). These enzymes catalyze the oxidation of NADH and the reduction of ubiquinone in the respiratory chain. The significance of these enzymes lies in their critical role in the respiratory protection mechanism that allows A. vinelandii to fix nitrogen aerobically despite nitrogenase's oxygen sensitivity . Studies have shown that NDH II is particularly induced under high oxygen conditions and during diazotrophic growth, suggesting its specialized role in oxygen management during nitrogen fixation . This respiratory protection allows A. vinelandii to maintain proper oxygen levels in the cytoplasm, preventing damage to the oxygen-sensitive nitrogenase complex.

How does the nuoK subunit contribute to NADH-quinone oxidoreductase function?

The nuoK subunit is an integral membrane component of the NDH I complex (proton-pumping NADH:ubiquinone oxidoreductase). While specific information about nuoK is limited in the provided search results, research on related bacterial systems indicates that nuoK contains three transmembrane helices and participates in forming the membrane domain of the complex. The subunit is believed to contribute to the proton translocation pathway, which is essential for energy conservation during respiration. Experimental approaches to studying nuoK function typically involve site-directed mutagenesis of conserved residues and subsequent analysis of proton pumping efficiency and enzyme activity.

What role does NADH-quinone oxidoreductase play in A. vinelandii's nitrogen fixation?

NADH-quinone oxidoreductase plays a vital role in A. vinelandii's ability to fix nitrogen aerobically by participating in the respiratory protection mechanism. In A. vinelandii, NDH II expression is specifically induced during diazotrophic growth and under high oxygen conditions . This induction pattern mirrors that of the bd-type quinol oxidase, another component crucial for respiratory protection. Mutant strains deficient in NDH II showed a marked decrease in respiratory activity and were unable to grow diazotrophically at high aeration, while maintaining normal growth at low aeration or in the presence of ammonium . This finding confirms that NDH II serves as a vital component of the respiratory protection mechanism that shields the nitrogenase complex from oxygen damage.

What experimental evidence supports the respiratory protection hypothesis in A. vinelandii?

The respiratory protection hypothesis, which suggests that high respiratory rates in A. vinelandii help maintain low intracellular oxygen concentrations to protect nitrogenase, is supported by several experimental findings:

  • NDH II-deficient mutant strains show decreased respiratory activity and are unable to grow diazotrophically at high aeration, while maintaining normal growth at low aeration .

  • The expression of NDH II and the bd-type oxidase are both induced under conditions requiring respiratory protection (high oxygen, diazotrophic growth) .

  • The CydR regulatory protein (homologous to E. coli FNR) controls both bd-type oxidase and NDH II expression, with cydR mutations leading to overproduction of the bd-type oxidase and induction of NDH II even at low oxygen concentrations .

These findings collectively demonstrate that A. vinelandii has evolved a specialized respiratory system that intensifies under nitrogen-fixing conditions to protect the oxygen-sensitive nitrogenase.

How can I design experiments to study nuoK function in A. vinelandii?

To study nuoK function in A. vinelandii, consider implementing the following experimental design approach:

Step 1: Gene Knockout/Mutation Strategy
Create a nuoK-deficient mutant strain using site-directed mutagenesis or gene replacement techniques. Based on successful approaches with NDH II, you can clone the nuoK gene, sequence it, and construct a knockout vector for homologous recombination .

Step 2: Phenotypic Characterization
Compare growth rates of wild-type and mutant strains under various conditions:

  • Different oxygen concentrations (low vs. high aeration)

  • Different nitrogen sources (N₂ vs. NH₄⁺)

  • Different carbon sources

Step 3: Biochemical Assays
Measure respiratory chain activity using:

  • NADH oxidation rates in membrane preparations

  • Proton pumping efficiency

  • Enzyme kinetics with varying substrate concentrations

Experimental ConditionWild Type (Expected)nuoK Mutant (Hypothetical)
High aeration, N₂Normal growthImpaired growth
Low aeration, N₂Normal growthNear-normal growth
High aeration, NH₄⁺Normal growthNormal growth
NADH oxidation rateHighReduced
Proton translocationEfficientImpaired

What controls are essential for NADH-quinone oxidoreductase activity assays?

When performing NADH-quinone oxidoreductase activity assays, the following controls are essential:

Positive Controls:

  • Purified commercial NADH dehydrogenase as an activity reference

  • Wild-type A. vinelandii membrane preparations

Negative Controls:

  • Heat-inactivated enzyme preparations

  • Reaction mixtures without enzyme

  • Reaction mixtures without substrate (NADH or quinone)

Specific Inhibitor Controls:

  • Include specific inhibitors of NDH I (e.g., rotenone)

  • Test with alternative substrates (e.g., dNADH, which is specifically oxidized by NDH I but not NDH II)

Methodological Considerations:

  • Monitor NADH oxidation by tracking the decrease in optical density at 340 nm

  • For kinetic determinations, analyze the first derivative of oxidation progress curves

  • Fit data to Michaelis-Menten equation using nonlinear regression analysis

This comprehensive control scheme will help distinguish between NDH I and NDH II activities and ensure reliable experimental results.

How can I optimize expression of recombinant nuoK in heterologous systems?

To optimize expression of recombinant nuoK in heterologous systems:

Expression System Selection:

  • For membrane proteins like nuoK, consider E. coli C41(DE3) or C43(DE3) strains specifically designed for membrane protein expression

  • Alternative systems include Bacillus subtilis or yeast systems for problematic expressions

Expression Optimization:

  • Modify the expression vector to include fusion tags that enhance folding (MBP, SUMO)

  • Optimize codon usage for the host organism

  • Test different induction conditions:

    • IPTG concentration (0.1-1.0 mM)

    • Induction temperature (16°C, 25°C, 30°C)

    • Induction duration (4h, overnight)

  • Add membrane-stabilizing agents to growth media

Purification Strategy:

  • Solubilize membranes with appropriate detergents (DDM, LMNG)

  • Purify using affinity chromatography with engineered tags

  • Verify protein integrity through SDS-PAGE and western blotting

Functional Verification:
Confirm activity using reconstitution assays in proteoliposomes to verify proper folding and function.

What methods can detect interactions between nuoK and other complex I subunits?

To investigate interactions between nuoK and other NADH-quinone oxidoreductase subunits, employ these methodological approaches:

Co-immunoprecipitation (Co-IP):
Express nuoK with an epitope tag and use antibodies to pull down the protein complex. Analyze co-precipitated proteins by mass spectrometry to identify interaction partners.

Crosslinking Studies:
Apply chemical crosslinkers to stabilize transient protein interactions within the complex, followed by mass spectrometry analysis to identify crosslinked peptides and determine spatial relationships.

FRET Analysis:
Tag nuoK and potential interaction partners with fluorescent proteins and measure Förster resonance energy transfer to detect close proximity in living cells.

Bacterial Two-Hybrid System:
Adapt bacterial two-hybrid systems to detect membrane protein interactions by fusing nuoK and other subunits to split reporter proteins.

Cryo-EM Structure Analysis:
If possible, determine the structure of the entire NADH-quinone oxidoreductase complex using cryo-electron microscopy to visualize nuoK's position and interactions.

These complementary approaches can provide comprehensive insights into nuoK's structural and functional relationships within the complex.

How should I approach contradictory results when studying nuoK function?

When facing contradictory results in nuoK functional studies, implement this systematic approach:

Step 1: Thoroughly Examine the Data
Begin by carefully examining all data to identify specific discrepancies . Compare your findings with existing literature and pay special attention to outliers that might influence results . Create a comprehensive table documenting all experimental variables and outcomes to visualize patterns in the contradictions.

Step 2: Reevaluate Experimental Design
Assess whether your experimental design contains methodological flaws. Consider implementing a Solomon 4-Group Design that includes both experimental and control groups with and without pretests to identify if testing procedures themselves influenced outcomes .

Step 3: Consider Alternative Hypotheses
Develop alternative explanations for the contradictory results, considering:

  • Post-translational modifications affecting nuoK function

  • Environmental factors influencing enzyme activity

  • Genetic compensation mechanisms in knockout strains

  • Differences in membrane composition affecting protein function

Step 4: Implement Validation Experiments
Design targeted experiments to specifically address contradictions using:

  • Alternative experimental techniques

  • Different genetic backgrounds

  • Various growth conditions

  • Independent laboratory validation

Remember that contradictory results often lead to new discoveries and research directions . Maintain detailed documentation throughout this process to track how interpretations evolve.

What statistical approaches are recommended for analyzing NADH-quinone oxidoreductase kinetic data?

For rigorous analysis of NADH-quinone oxidoreductase kinetic data, employ these statistical approaches:

Michaelis-Menten Kinetics Analysis:
The primary approach involves fitting oxidation rate data to the Michaelis-Menten equation using nonlinear regression analysis . This yields key parameters including Km and Vmax values.

Lineweaver-Burk and Eadie-Hofstee Transformations:
While nonlinear regression is preferred, these linear transformations can provide visual confirmation of enzyme behavior and help identify inhibition patterns.

Statistical Validation:

  • Calculate 95% confidence intervals for all kinetic parameters

  • Perform residual analysis to verify goodness of fit

  • Use Akaike Information Criterion (AIC) to compare different kinetic models

Experimental Replication Analysis:

  • Conduct a minimum of three independent experiments

  • Perform both technical and biological replicates

  • Apply ANOVA with appropriate post-hoc tests for comparing conditions

Handling Substrate Inhibition:
When enzyme activity decreases at high substrate concentrations, apply modified kinetic equations that incorporate substrate inhibition parameters.

This comprehensive statistical approach ensures robust interpretation of kinetic data while accounting for experimental variability.

How can I use bioinformatics to compare nuoK sequences across bacterial species?

To effectively compare nuoK sequences across bacterial species, implement this bioinformatics workflow:

Step 1: Sequence Collection and Alignment

  • Retrieve nuoK sequences from diverse bacterial species using BLAST searches against the A. vinelandii sequence

  • Generate multiple sequence alignments using MUSCLE or MAFFT algorithms

  • Visualize alignments in Jalview or similar tools to identify conserved regions

Step 2: Phylogenetic Analysis

  • Construct phylogenetic trees using Maximum Likelihood or Bayesian methods

  • Assess node support with bootstrap analysis (>1000 replicates)

  • Correlate evolutionary relationships with known taxonomic classifications

Step 3: Functional Domain Analysis

  • Identify transmembrane domains using TMHMM or Phobius

  • Map conserved residues to functional domains

  • Predict critical residues through conservation scoring (ConSurf)

Step 4: Structural Modeling

  • Generate structural models using homology modeling tools like SWISS-MODEL

  • Validate models with PROCHECK and MolProbity

  • Map conserved residues onto 3D structures to visualize functional implications

This comprehensive approach allows identification of evolutionarily conserved features that likely represent functionally important regions of the nuoK protein.

What software tools are recommended for analyzing nuoK membrane topology?

For comprehensive analysis of nuoK membrane topology, utilize this suite of complementary computational tools:

Transmembrane Helix Prediction:

  • TMHMM: Provides probability scores for transmembrane regions

  • Phobius: Combined transmembrane topology and signal peptide predictor

  • MEMSAT: Uses neural networks for topology prediction

  • TOPCONS: Consensus predictor combining multiple algorithms

Hydrophobicity Analysis:

  • Kyte-Doolittle plots: Visualize hydrophobic regions with scanning windows

  • WHAT 2.0: Web-based hydrophobicity analysis tool

3D Structure Prediction:

  • AlphaFold2: State-of-the-art deep learning approach for protein structure prediction

  • I-TASSER: Hierarchical approach to protein structure and function prediction

  • RoseTTAFold: Neural network-based structure prediction

Topology Validation Tools:

  • PhoA/LacZ fusion analysis planners: Design experimental validations

  • RHYTHM: Plans optimal reporter fusion experiments

Analysis TypeRecommended ToolsOutput Format
TM Helix PredictionTMHMM, PhobiusProbability plots, 2D diagrams
HydrophobicityKyte-Doolittle, WHAT 2.0Hydropathy plots
3D StructureAlphaFold2, I-TASSERPDB files, confidence scores
Experimental DesignRHYTHMFusion construct designs

For most accurate results, compare predictions from multiple tools and reconcile discrepancies based on experimental data.

How does nuoK contribute to proton translocation in NADH-quinone oxidoreductase?

The nuoK subunit likely plays a critical role in the proton translocation pathway of NADH-quinone oxidoreductase complex I (NDH I). Based on research in related bacterial systems, nuoK contains several key structural features that facilitate proton movement:

  • Conserved Charged Residues: The transmembrane helices of nuoK contain strategically positioned charged amino acids (particularly lysine and glutamic acid residues) that likely form part of the proton channel.

  • Conformational Changes: During enzyme catalysis, NADH oxidation at the peripheral arm induces conformational changes that propagate to the membrane domain where nuoK resides. These structural rearrangements may open and close specific proton pathways.

  • Quinone Binding Site Proximity: While nuoK itself may not directly bind quinone, its position relative to the quinone binding site suggests involvement in coupling electron transfer to proton translocation.

  • Water Molecule Coordination: NuoK likely participates in organizing internal water molecules that form proton-conducting networks through the membrane domain.

Experimental approaches to study nuoK's role in proton translocation include site-directed mutagenesis of conserved residues followed by measurement of proton pumping efficiency in reconstituted proteoliposomes.

What are the evolutionary implications of nuoK conservation across bacterial species?

The evolutionary conservation of nuoK across diverse bacterial species reveals important insights about the fundamental nature of bioenergetic systems:

Conservation Patterns:
NuoK shows remarkable sequence conservation in its transmembrane regions across phylogenetically distant bacteria, suggesting functional constraints that prevent extensive sequence divergence. This conservation is particularly pronounced in residues that face the protein interior rather than the membrane lipids.

Co-evolution with Partner Subunits:
Correlation analysis reveals that nuoK evolution is tightly linked with other membrane subunits of complex I, indicating cooperative functional constraints. This co-evolutionary pattern helps identify interacting surfaces between subunits.

Minimal Complex I:
Some bacterial lineages possess simplified versions of complex I with fewer subunits, yet nuoK is nearly always retained, emphasizing its essential function in the core mechanism of the enzyme.

Alternative NADH Dehydrogenases:
The presence of alternative NADH dehydrogenases like NDH II in A. vinelandii represents an interesting evolutionary adaptation providing respiratory flexibility . While NDH II lacks proton pumping ability, it offers advantages under specific conditions, explaining why both systems often coexist.

These evolutionary patterns highlight nuoK's critical role in the core function of complex I across the bacterial domain.

What novel experimental approaches could advance research on nuoK function?

Several cutting-edge experimental approaches could significantly advance our understanding of nuoK function:

CRISPR-Cpf1 Base Editing System:
Develop a precise genome editing protocol for A. vinelandii using CRISPR-Cpf1 to create specific point mutations in nuoK without disrupting the reading frame. This would allow creation of subtle mutations that alter function without completely eliminating the protein.

Single-Molecule FRET Microscopy:
Apply single-molecule Förster resonance energy transfer to monitor conformational changes in nuoK during catalysis in real-time. This approach requires labeling specific residues with fluorophore pairs and can reveal dynamic structural changes previously undetectable.

Cryo-Electron Tomography:
Visualize intact NADH-quinone oxidoreductase complexes in their native membrane environment at near-atomic resolution. This technique would provide structural context for nuoK within the fully assembled complex.

Hydrogen-Deuterium Exchange Mass Spectrometry:
Map conformational dynamics and solvent accessibility changes in nuoK under different functional states to identify regions involved in proton translocation and subunit interactions.

Participatory Research Approach:
Implement a participatory research methodology that brings together experts from different fields (biochemistry, structural biology, computational modeling) . This interdisciplinary approach can provide novel perspectives on complex questions regarding nuoK function.

These innovative approaches could overcome current technical limitations and provide unprecedented insights into nuoK's role in energy conservation.

How might nuoK function contribute to A. vinelandii's unique nitrogen fixation capabilities?

The nuoK subunit of NADH-quinone oxidoreductase likely plays a specialized role in supporting A. vinelandii's remarkable ability to fix nitrogen aerobically:

Energy Conservation Efficiency:
As part of the proton-pumping NDH I complex, nuoK contributes to maximizing energy conservation through its role in proton translocation. This energy efficiency is critical during nitrogen fixation, which is highly energy-intensive (requiring ~16 ATP molecules per N₂ reduced) .

Respiratory Balancing:
A. vinelandii possesses both NDH I (containing nuoK) and NDH II, which likely work in a coordinated fashion to balance energy conservation needs with oxygen consumption rates . NuoK's function in NDH I may be fine-tuned to optimize this balance during nitrogen fixation.

Oxygen Sensitivity Response:
The expression and activity of respiratory complexes in A. vinelandii are regulated by oxygen concentration and nitrogen availability . NuoK may contain specific structural features that enhance complex I stability or activity under the high-respiration conditions needed for respiratory protection.

Redox Balance Maintenance:
Nitrogen fixation requires precise maintenance of cellular redox balance. The proton-pumping activity of NDH I, facilitated by nuoK, may contribute to maintaining optimal proton motive force and redox poise during diazotrophic growth.

Understanding nuoK's specific contributions could provide insights into the remarkable adaptation that allows A. vinelandii to fix nitrogen aerobically despite nitrogenase's oxygen sensitivity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.