Recombinant Azotobacter vinelandii Probable intracellular septation protein A (Avin_15630)

Shipped with Ice Packs
In Stock

Description

Functional Insights

Role in Nitrogen Fixation:

  • Avin_15630 is non-essential under diazotrophic (nitrogen-fixing) growth, as demonstrated by transposon sequencing (Tn-seq) fitness studies .

  • This suggests functional redundancy in A. vinelandii’s nitrogen fixation machinery, where other proteins compensate for Avin_15630 disruption .

Hypothesized Role:

Research Applications

Protein Expression Studies:

  • Used to investigate oxygen-sensitive protein production in A. vinelandii, leveraging its ability to maintain intracellular anaerobic conditions .

  • Serves as a model for studying recombinant protein expression in non-E. coli systems, particularly under anaerobic conditions .

Biochemical Assays:

  • Available as a lyophilized antigen for ELISA-based studies, enabling antibody development and protein interaction analyses .

Comparative Genomic Context

Genomic Location:

  • Located in a region of the A. vinelandii genome distinct from ATP synthase operons or alginate biosynthesis clusters .

Orthologs:

  • Limited homology to septation proteins in other Gram-negative bacteria, suggesting a unique functional adaptation in A. vinelandii.

Challenges and Future Directions

  • Functional Characterization: The exact biochemical role of Avin_15630 requires further validation via knockout studies or structural analyses (e.g., cryo-EM).

  • Biotechnological Potential: Its non-essential nature under nitrogen fixation makes it a candidate for metabolic engineering without disrupting core cellular processes.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. The shelf life for the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize development of the specified tag.
Synonyms
yciB; Avin_15630; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Target Names
Avin_15630
Target Protein Sequence
MKQFIDFIPLILFFIVYKLEPRIVELAGHSFTFGGIFSATAVLILASLLVYGTLFLIQRR LEKGQWITLLACLVFGGMTLTFQSETFLKWKAPVVNWLFALGFAASHFIGDRPLIQRILG HAVSLPAPLWTRLNLAWVAFFVFSGCANLFVAFTFHEFWVDFKVFGSLGMTVLFLVGQGV FLARHMHEHSTESAAKSKD
Uniprot No.

Target Background

Function
Plays a role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does the expression system affect the functionality of this recombinant protein?

The choice of expression system significantly impacts the functionality of recombinant proteins. For Azotobacter vinelandii Probable intracellular septation protein A, E. coli has been selected as the expression host . While E. coli offers advantages of rapid growth and high protein yields, researchers should consider several factors:

  • Post-translational modifications: Since E. coli lacks many eukaryotic post-translational modification mechanisms, any native modifications in Azotobacter might be absent in the recombinant form.

  • Protein folding: Bacterial septation proteins often contain membrane-spanning domains that may not fold properly in high-expression systems, potentially leading to inclusion bodies.

  • Functionality assessment: To verify proper folding and functionality, researchers should conduct activity assays specific to septation proteins, such as GTPase activity measurements or membrane binding assays.

If functional issues arise with E. coli-expressed protein, alternative expression systems could include yeast or insect cells, which might better accommodate the folding requirements of membrane-associated proteins .

What are the recommended storage conditions to maintain protein stability?

For optimal stability of the Recombinant Azotobacter vinelandii Probable intracellular septation protein A, follow these evidence-based storage guidelines:

  • Short-term storage: Store working aliquots at 4°C for up to one week to minimize degradation during active research periods .

  • Long-term storage: Store at -20°C or preferably -80°C upon receipt .

  • Aliquoting strategy: Divide the protein into small single-use aliquots immediately upon reconstitution to prevent repeated freeze-thaw cycles, which can significantly compromise protein integrity .

  • Reconstitution considerations: When reconstituting the lyophilized powder, use buffers that maintain physiological pH (typically 7.2-7.4) with appropriate ionic strength to preserve native conformation.

  • Stability monitoring: Periodically verify protein integrity using SDS-PAGE or size exclusion chromatography to detect potential degradation products.

These storage recommendations are particularly important for membrane-associated proteins like septation proteins, which tend to be more susceptible to denaturation during freeze-thaw cycles compared to soluble proteins.

How can researchers optimize co-immunoprecipitation assays to identify binding partners of Azotobacter vinelandii septation protein A?

Optimizing co-immunoprecipitation (Co-IP) assays for identifying binding partners of septation protein A requires careful consideration of several parameters. Based on successful approaches with similar proteins, the following protocol modifications are recommended:

  • Cross-linking optimization: For transient protein-protein interactions common in cell division machinery, use adjustable cross-linking with DSP (dithiobis[succinimidyl propionate]) at concentrations between 0.5-2 mM for 20-30 minutes.

  • Lysis buffer composition:

    • For membrane proteins like septation protein A, use buffers containing:

      • 25 mM HEPES (pH 7.4)

      • 150 mM NaCl

      • 1% digitonin or 0.5-1% DDM (n-dodecyl β-D-maltoside)

      • Protease inhibitor cocktail

      • 1 mM PMSF

  • Antibody selection: If using the His-tagged recombinant protein, anti-His antibodies coupled to magnetic beads provide efficient capture while allowing native protein interactions .

  • Control experiments:

    • Use non-specific IgG as negative control

    • Include RNase A treatment controls to eliminate RNA-mediated indirect interactions

    • Perform reciprocal Co-IPs to validate interactions

The pull-down efficiency can be evaluated using western blotting, with >90% purity of the recombinant protein serving as a good starting point for interaction studies .

What experimental approaches can resolve discrepancies in localization studies of septation protein A?

When facing discrepancies in localization studies of septation protein A, a multi-modal approach combining complementary techniques is recommended:

  • Fluorescence microscopy optimization:

    • Compare results using both N- and C-terminal fluorescent protein fusions

    • Verify functionality of fusion proteins by complementation assays

    • Use photoactivatable fluorescent tags for pulse-chase experiments to track protein dynamics during cell division

  • Super-resolution techniques:

    • Implement STORM or PALM microscopy to achieve 20-50 nm resolution

    • Use structured illumination microscopy (SIM) for live-cell imaging during the septation process

  • Biochemical fractionation validation:

    • Perform subcellular fractionation with differential centrifugation

    • Analyze fractions by western blotting with anti-His antibodies to detect the tagged protein

    • Compare results across multiple growth phases

  • Electron microscopy correlation:

    • Use immunogold labeling with antibodies against the His tag

    • Implement cryo-electron tomography to visualize septation complexes in their native state

  • Controlled expression systems:

    • Use inducible promoters to assess localization at different expression levels

    • Compare results between heterologous and homologous expression systems

This integrated approach will help distinguish genuine localization patterns from artifacts and resolve discrepancies in experimental data.

How does the probable septation protein A interact with the bacterial divisome complex?

Understanding the interaction between Azotobacter vinelandii septation protein A and the divisome complex requires systematic investigation of potential binding partners and functional relationships:

  • Protein interaction network analysis:

    • Perform bacterial two-hybrid (B2H) or split-GFP assays to screen for interactions with known divisome components (FtsZ, FtsA, ZipA, FtsK)

    • Use the His-tagged recombinant protein for pull-down assays followed by mass spectrometry to identify novel interaction partners

  • Temporal assembly investigation:

    • Implement time-lapse microscopy with fluorescently labeled proteins

    • Analyze recruitment order using inducible depletion systems

  • Structural domains involved in interactions:

    • Create a panel of truncated constructs to map interaction domains

    • Introduce site-directed mutations in conserved residues to identify critical interaction sites

    • Based on the amino acid sequence (provided in the specifications), focus on hydrophobic regions that may mediate protein-protein interactions

  • Functional redundancy assessment:

    • Perform complementation studies with homologs from related species

    • Analyze synthetic phenotypes in combination with mutations in other divisome components

Potential Divisome ComponentExpected Interaction TechniqueDetection Method
FtsZCo-IP, B2HWestern blot, Growth assay
FtsACo-IP, B2HWestern blot, Growth assay
FtsKPull-downMass spectrometry
ZipACo-IPWestern blot
FtsNCrosslinkingSDS-PAGE

These systematic approaches will help establish the role of septation protein A within the complex network of divisome proteins.

What are the optimal purification conditions for maintaining the native conformation of Azotobacter vinelandii septation protein A?

Maintaining the native conformation of septation protein A during purification requires careful optimization of multiple parameters:

  • Buffer composition optimization:

    • pH range: Test buffers at pH 7.0-8.0 to determine optimal stability

    • Salt concentration: Typically 150-300 mM NaCl to maintain solubility while preventing non-specific interactions

    • Stabilizing additives: Include 5-10% glycerol and 1-5 mM DTT to prevent aggregation and oxidation

    • Detergent selection: For membrane-associated proteins like septation protein A, mild detergents such as 0.05% DDM or 0.1% CHAPS help maintain native conformation

  • Multi-step purification strategy:

    • Initial capture: Ni-NTA affinity chromatography utilizing the N-terminal His tag

    • Intermediate purification: Ion exchange chromatography based on the protein's theoretical pI

    • Polishing step: Size exclusion chromatography to separate monomeric protein from aggregates

    • Quality control: Verify >90% purity by SDS-PAGE as indicated in the specifications

  • Temperature considerations:

    • Maintain all purification steps at 4°C to minimize proteolytic degradation

    • Include protease inhibitors (PMSF, leupeptin, aprotinin) in all buffers

  • Conformation verification methods:

    • Circular dichroism spectroscopy to assess secondary structure integrity

    • Dynamic light scattering to check for aggregation

    • Limited proteolysis to verify proper folding

Following these guidelines will help preserve the native conformation of the protein, which is essential for subsequent structural and functional studies.

How can researchers effectively design assays to measure the GTPase activity of septation protein A?

Designing effective GTPase activity assays for septation protein A requires careful consideration of assay conditions and controls:

  • Colorimetric phosphate detection method:

    • Reaction mix: 50 mM Tris-HCl (pH 7.5), 5 mM MgCl₂, 1 mM DTT, 0.1 mg/ml BSA, 0.2 mM GTP

    • Protein concentration: Titrate purified recombinant protein from 0.1-5 μM to determine optimal concentration

    • Detection: Malachite green assay to quantify released inorganic phosphate

    • Controls: Include no-protein and no-GTP controls

  • HPLC-based nucleotide analysis:

    • Separate GDP from GTP using reverse-phase chromatography

    • Monitor the GTP:GDP ratio over time to calculate reaction rates

    • Use C18 columns with isocratic elution for optimal separation

  • Coupled-enzyme assay system:

    • Link GTP hydrolysis to NADH oxidation via pyruvate kinase and lactate dehydrogenase

    • Monitor decrease in absorbance at 340 nm in real-time

    • Advantages: Continuous measurement, high sensitivity

  • Factors affecting activity to investigate:

    • Divalent cation dependency: Test Mg²⁺, Mn²⁺, and Ca²⁺ at 1-10 mM

    • pH dependency: Evaluate activity across pH range 6.5-8.5

    • Temperature optimum: Test at 25°C, 30°C, and 37°C

    • Effect of membrane mimetics: Include liposomes or nanodiscs to simulate natural environment

  • Data analysis recommendations:

    • Calculate kinetic parameters (Km, Vmax) using Michaelis-Menten equation

    • Use Lineweaver-Burk plots to identify inhibition patterns

    • Report specific activity in nmol Pi released/min/mg protein

These methodological considerations will ensure reliable measurement of the intrinsic GTPase activity of septation protein A, providing insights into its functional mechanisms.

What techniques can identify post-translational modifications in naturally occurring versus recombinant septation protein A?

Identifying and comparing post-translational modifications (PTMs) between naturally occurring and recombinant septation protein A requires sophisticated analytical techniques:

  • Mass spectrometry-based approaches:

    • Bottom-up proteomics: Digest protein with trypsin and analyze resulting peptides by LC-MS/MS

    • Top-down proteomics: Analyze intact protein to preserve all modifications

    • Targeted analysis: Use multiple reaction monitoring (MRM) for specific modifications

    • Enrichment strategies: Implement phosphopeptide enrichment using TiO₂ for phosphorylation analysis

  • Site-specific modification detection:

    • Phosphorylation: Use phospho-specific antibodies or Phos-tag SDS-PAGE

    • Glycosylation: Employ lectin blotting or PNGase F treatment followed by mobility shift analysis

    • Lipidation: Use click chemistry with alkyne-tagged lipids for detection

    • Acetylation: Implement anti-acetyl lysine antibodies for western blotting

  • Comparative analysis workflow:

    • Extract native protein from Azotobacter vinelandii using gentle lysis conditions

    • Purify recombinant protein from E. coli expression system

    • Process both samples in parallel using identical protocols

    • Compare modification patterns and quantify differences

  • Validation experiments:

    • Confirm MS identification with site-directed mutagenesis of modified residues

    • Assess functional consequences of modifications using activity assays

    • Reconstitute modification in vitro using purified modification enzymes

This systematic approach will reveal differences in PTMs between naturally occurring and recombinant proteins, providing crucial information for researchers working with the E. coli-expressed recombinant protein .

What are the key considerations for experimental design when studying septation protein A function in cellular models?

When designing experiments to study septation protein A function in cellular models, researchers should consider these integrated approaches:

  • Model system selection:

    • Native Azotobacter vinelandii systems provide the most physiologically relevant context

    • Heterologous expression in E. coli offers experimental tractability while potentially lacking species-specific factors

    • Consider complementation experiments in septation-deficient bacterial strains

  • Experimental validation hierarchy:

    • Begin with biochemical characterization of the purified recombinant protein

    • Progress to in vitro reconstitution with potential binding partners

    • Advance to cellular localization studies during different growth phases

    • Culminate with functional complementation and phenotypic analysis

  • Controls and standards implementation:

    • Include parallel experiments with well-characterized septation proteins

    • Use site-directed mutagenesis to generate non-functional controls

    • Implement inducible expression systems to create gradients of protein levels

    • Design proper negative controls for all interaction studies

  • Integrated data analysis framework:

    • Correlate biochemical activities with cellular phenotypes

    • Implement quantitative image analysis for localization studies

    • Utilize statistical methods appropriate for the experimental design

    • Consider computational modeling to integrate diverse datasets

By following these research guidelines, investigators can develop robust experimental designs that address the multifaceted aspects of septation protein A function while minimizing experimental artifacts and misinterpretations.

How should contradictory findings about septation protein A function be reconciled in the scientific literature?

When facing contradictory findings about septation protein A function in the scientific literature, researchers should implement a systematic approach to reconciliation:

  • Methodological differences analysis:

    • Compare protein preparation methods, including expression systems and purification protocols

    • Assess differences in buffer compositions and storage conditions

    • Evaluate experimental conditions such as temperature, pH, and ionic strength

    • Consider the impact of tags (such as the N-terminal His tag in the recombinant protein)

  • Biological context variations:

    • Analyze strain differences in studies using Azotobacter vinelandii

    • Consider growth phase variations and their impact on septation

    • Evaluate media composition effects on protein expression and function

    • Assess potential differences in interacting partners across experimental systems

  • Technical limitations recognition:

    • Identify resolution limits of imaging techniques used in localization studies

    • Consider sensitivity thresholds of biochemical assays

    • Acknowledge limitations of heterologous expression systems

    • Evaluate statistical power of contradictory studies

  • Integrative resolution strategies:

    • Design definitive experiments addressing specific contradictions

    • Implement multiple complementary techniques to examine the same question

    • Consider collaborative research with labs reporting contradictory results

    • Develop unified models that incorporate conditional functionality

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.