Recombinant Azotobacter vinelandii Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Enzyme Overview

Undecaprenyl-diphosphatase (UppP; EC 3.6.1.27) is a membrane-associated hydrolase that participates in bacterial cell wall biogenesis. In Azotobacter vinelandii, the recombinant form of this enzyme is engineered for biochemical and structural studies. Key features include:

  • Catalytic Reaction:
    undecaprenyl diphosphate+H2Oundecaprenyl phosphate+phosphate\text{undecaprenyl diphosphate} + \text{H}_2\text{O} \rightleftharpoons \text{undecaprenyl phosphate} + \text{phosphate} .

  • Biological Role: Generates the lipid carrier C55-P, which transports peptidoglycan precursors across the cytoplasmic membrane .

  • Antibiotic Resistance: Confers bacitracin resistance by replenishing C55-P, which is sequestered by bacitracin-metal complexes .

Expression Systems

Recombinant UppP from A. vinelandii is produced in heterologous systems:

ParameterDetails
Host SystemsE. coli (C41 (DE3)) , baculovirus
InductionIPTG (0.5 mM) and retinal (5–10 mM) for E. coli
PurificationMembrane fraction solubilized in Tris-NaCl buffer with n-dodecyl-β-D-maltoside

Sequence and Domains

  • UniProt ID: C1DLV7 .

  • Amino Acid Sequence: Residues 1–277 (full-length protein) with conserved motifs:

    • (E/Q)XXXE: Proposed substrate-binding site .

    • PGXSRSXXT: Catalytic motif involved in phosphate hydrolysis .

Kinetic and Physical Data

PropertyValue
Optimal pH7.5 (Tris buffer)
Cation DependenceEnhanced by Ca²⁺
Molecular Weight~33 kDa (calculated for 277 residues)
Purity>85% (SDS-PAGE) , >90% (lyophilized form)

Research Applications

  • Mechanistic Studies: Used to elucidate the role of conserved residues (e.g., histidine, glutamate) in substrate binding and catalysis .

  • Drug Discovery: High-throughput screens for UppP inhibitors (e.g., clomiphene) to combat antibiotic-resistant pathogens .

  • Structural Biology: Homology modeling based on E. coli UppP structures (PDB: 5OON, 6CB2) informs A. vinelandii enzyme dynamics .

Key Research Findings

  • Active Site Architecture: Molecular dynamics simulations suggest a periplasmic orientation for substrate access in E. coli UppP, likely conserved in A. vinelandii .

  • Mutagenesis Insights: Substitutions in the PGXSRSXXT motif reduce activity by >80%, highlighting its catalytic necessity .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; Avin_28720; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-277
Protein Length
full length protein
Species
Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Target Names
uppP
Target Protein Sequence
MELWLAAQAFILGVVEGLTEFLPISSTGHQIIIADLIGFGGDRAKAFNIIIQLGAILAVV WEFREKVFGVILGLPREPQAQRFTVNLLIAFLPAVVLGVAFADLIEHWLFNPITVASALV VGGLVMLWAERRQHVIEVHAVDEMNWRHALKIGCAQCLAMIPGTSRSGSTIIGGLLFGLS RKAATEFSFFLAMPTMVGAAAYSGYKHRALFENGGDLPVFALGFVVSFIFAMLAVRGLLR FIASHSYALFAWYRIGFGLLILLTWQLGVVDWSTAQG
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic function of Undecaprenyl-diphosphatase (uppP) in Azotobacter vinelandii?

Undecaprenyl-diphosphatase (uppP) catalyzes the dephosphorylation of undecaprenyl pyrophosphate (UPP) to undecaprenyl phosphate (UP), a critical reaction in bacterial cell wall synthesis. This enzyme plays an essential role in the bacterial phospholipid recycling pathway, where UP serves as a sugar carrier lipid in the biosynthesis of various bacterial extracellular polysaccharides including peptidoglycan, O-antigen, and other cell wall components . In the context of Azotobacter vinelandii, this enzyme contributes to cell envelope integrity while supporting the organism's notable capacity for nitrogen fixation and biopolymer production.

What are the optimal expression systems for producing recombinant Azotobacter vinelandii uppP?

The optimal expression system for recombinant A. vinelandii uppP depends on the research objectives. Based on comparable studies with membrane proteins and specifically with phosphatases, the following expression approaches have demonstrated success:

  • E. coli expression systems: The pTrc99A vector has been successfully used for expression of similar proteins from Azotobacter vinelandii . For uppP specifically, E. coli BL21(DE3) with pET-based vectors containing appropriate fusion tags offers a suitable starting point.

  • Expression optimization parameters:

    • Induction with 0.1-0.5 mM IPTG

    • Growth temperature reduction to 16-18°C post-induction

    • Supplementation with 10 mM CaCl₂ in growth media to stabilize membrane protein expression

    • Extended expression periods (12-16 hours) at reduced temperatures

  • Fusion strategies: N-terminal His₆-tag or MBP fusion proteins can enhance solubility and facilitate purification.

For integral membrane proteins like uppP, expression levels must be carefully optimized to prevent cytotoxicity due to membrane disruption. Using specialized E. coli strains designed for membrane protein expression, such as C41(DE3) or C43(DE3), can significantly improve yields .

What purification strategies are effective for isolating Azotobacter vinelandii uppP while maintaining enzymatic activity?

Purification of membrane-bound enzymes like uppP requires specialized approaches to maintain native conformation and activity:

  • Membrane fraction isolation:

    • Cell lysis by pressure disruption (French press) or sonication in buffer containing 50 mM HEPES, pH 7.5, 150 mM NaCl, 10% glycerol, and protease inhibitors

    • Differential centrifugation to isolate membrane fractions (30,000-100,000 × g)

  • Detergent solubilization:

    • Recommended detergents: n-dodecyl-β-D-maltoside (DDM, 1-2%), or digitonin (1%)

    • Solubilization buffer: 50 mM HEPES, pH 7.5, 300 mM NaCl, 10% glycerol, selected detergent

    • Gentle rotation for 1-2 hours at 4°C followed by ultracentrifugation

  • Affinity chromatography:

    • For His-tagged protein: Ni-NTA resin with step gradients of imidazole (20-250 mM)

    • Buffer composition: 50 mM HEPES, pH 7.5, 300 mM NaCl, 0.03-0.05% DDM, 10% glycerol

  • Secondary purification:

    • Size exclusion chromatography using Superdex 200 column

    • Buffer: 20 mM HEPES, pH 7.5, 150 mM NaCl, 0.03% DDM, 10% glycerol

When storing the purified enzyme, inclusion of 50% glycerol and storage at -20°C has been shown to maintain activity for recombinant proteins from A. vinelandii . Alternatively, flash-freezing small aliquots in liquid nitrogen and storage at -80°C can preserve activity for extended periods.

What assay methods are available for measuring uppP enzymatic activity?

Several complementary methods can be employed to measure uppP enzymatic activity:

  • Radioactive phosphate release assay:

    • Incubation of enzyme with [³²P]-labeled UPP substrate

    • Reaction in buffer containing 50 mM HEPES (pH 7.5), 10 mM MgCl₂, 100 mM NaCl, 0.1% Triton X-100

    • Separation of released [³²P] phosphate using thin-layer chromatography (TLC)

    • Quantification using phosphorimaging

  • Malachite green phosphate detection:

    • Non-radioactive alternative measuring released inorganic phosphate

    • Colorimetric detection at 620-640 nm

    • Suitable for high-throughput screening

  • HPLC-based assays:

    • Detection of UPP substrate depletion and UP product formation

    • Requires C8 or C18 reverse-phase chromatography with appropriate mobile phase gradients

    • Detection by UV absorbance (205-210 nm) or mass spectrometry

Assay MethodDetection LimitAdvantagesLimitations
Radioactive assay5-10 pmolHigh sensitivity; direct measurementRequires radioactive handling; specialized disposal
Malachite green0.1-1 nmolHigh-throughput compatible; non-radioactiveIndirect measurement; susceptible to phosphate contamination
HPLC10-50 pmolDirect product identification; quantitativeRequires specialized equipment; lower throughput

Temperature and pH optima for A. vinelandii uppP activity typically range between 25-37°C and pH 7.0-8.0, respectively, with activity enhanced in the presence of divalent cations (Mg²⁺, Ca²⁺) and potentially inhibited by specific detergents.

How can researchers overcome challenges in obtaining functional undecaprenyl pyrophosphate substrate for uppP assays?

The limited commercial availability of the natural substrate undecaprenyl pyrophosphate presents a significant challenge for uppP assay development. Researchers can address this through several approaches:

  • Chemical synthesis routes:

    • Total chemical synthesis of UPP following established protocols

    • Semi-synthetic approaches starting with polyprenol or dolichol precursors

  • Enzymatic synthesis:

    • In vitro enzymatic synthesis using undecaprenol kinase and a pyrophosphate donor

    • Cell-free extract systems from bacterial sources that naturally produce UPP

  • Substrate analogs:

    • Shorter chain analogs (C₅₅-C₃₅) show activity with reduced specificity

    • Fluorescently labeled analogs for non-radioactive detection methods

    • Biotinylated analogs for pull-down assays or surface plasmon resonance studies

  • Commercial sources:

    • Specialized lipid suppliers provide limited quantities of UPP

    • Consider collaborative approaches with natural products chemistry laboratories

For kinetic studies, researchers should validate that substrate analogs behave comparably to the natural substrate through parallel experiments with the natural substrate when available, even in limited quantities. Reported Km values for UPP with bacterial UPP phosphatases typically range from 20-100 μM, suggesting assays should employ substrate concentrations spanning this range when feasible.

How does uppP activity relate to bacterial exopolysaccharide production in Azotobacter vinelandii?

Azotobacter vinelandii produces several industrially and pharmaceutically valuable exopolysaccharides, most notably alginate. The connection between uppP activity and exopolysaccharide production is fundamentally linked through the undecaprenyl phosphate (UP) carrier cycle:

  • UP as an essential carrier lipid: uppP generates UP, which serves as a lipid anchor for initial sugar-1-phosphate residues in exopolysaccharide synthesis. In the case of alginate biosynthesis, UP anchors the first sugar precursor before additional monomers are added .

  • Effect on exopolysaccharide production rates: The availability of UP, determined partly by uppP activity, can become a rate-limiting factor in exopolysaccharide production. Experimental evidence suggests that modulation of UP recycling pathways can alter the flux toward specific polysaccharide biosynthesis .

  • Integration with regulatory systems: Exopolysaccharide synthesis in A. vinelandii is regulated by multiple systems, including the RcsAB regulatory system that controls transcription of genes involved in capsule biosynthesis. The RcsAB system binds to a specific operator (RcsAB box) to activate transcription of genes in colanic acid biosynthesis, which also utilizes UP as a carrier lipid .

In the context of A. vinelandii, biosynthesis of alginate involves a complex pathway where genes such as algW and amrZ are required for alginate production. The uppP-generated UP serves as the initial carrier for the assembly of mannuronic acid units before their export and polymerization. The subsequent epimerization of these units by enzymes like AlgE2 and AlgE4 creates the final alginate polymer structure with distinctive sequence patterns .

What is the relationship between uppP activity and bacterial resistance to antimicrobial compounds?

The relationship between uppP activity and antimicrobial resistance involves several mechanisms:

  • Direct role in bacitracin resistance: uppP (also known as bacitracin resistance protein in some organisms) contributes directly to resistance against the antibiotic bacitracin. Bacitracin binds to undecaprenyl pyrophosphate (UPP) and prevents its dephosphorylation, thereby inhibiting cell wall synthesis. Increased uppP activity can overcome this inhibition by maintaining adequate UP levels .

  • Cell wall integrity maintenance: By ensuring appropriate UP recycling, uppP activity supports robust cell wall synthesis, which is critical for innate resistance to various antimicrobials targeting cell envelope integrity.

  • Biofilm formation influence: UP availability affects exopolysaccharide production, which in turn influences biofilm formation. Robust biofilms provide increased resistance to antimicrobial compounds through physical barrier effects and altered physiological states.

Research with other bacterial species has established that overexpression of UPP phosphatases can increase resistance to bacitracin by factors of 4-8 fold, suggesting similar effects may be observed in A. vinelandii. This relationship makes uppP a potential target for combination therapies that could enhance the efficacy of cell wall-targeting antibiotics.

What gene knockout or modification strategies are most effective for studying uppP function in Azotobacter vinelandii?

Investigating uppP function through genetic manipulation requires careful consideration of its essential nature in bacterial cell wall biosynthesis. Several approaches have proven effective:

  • Conditional knockout strategies:

    • Inducible promoter replacement (tetracycline-responsive or IPTG-inducible systems)

    • Temperature-sensitive alleles that function normally at permissive temperatures

    • Depletion strains where expression can be gradually reduced

  • Site-directed mutagenesis approaches:

    • Targeted modification of active site residues in the conserved (E/Q)XXXE and PGXSRSXXT motifs

    • Conservative substitutions that maintain protein folding but alter catalytic efficiency

    • Creation of chimeric enzymes with domains from related phosphatases

  • Gene delivery methods for A. vinelandii:

    • Tri-parental mating using helper strains and appropriate vectors

    • Electroporation with specialized conditions for A. vinelandii competence

    • Integration via homologous recombination using suicide vectors

For successful genomic manipulation in A. vinelandii, vectors such as pTrc99A have been utilized . When designing knockout strategies, parallel complementation experiments should be conducted using plasmid-based expression of wild-type uppP to confirm phenotype specificity.

Due to the essential nature of UP in bacterial cell wall synthesis, complete deletion of functional uppP is likely lethal unless redundant phosphatases exist in A. vinelandii. Therefore, partial loss-of-function approaches are often more informative for studying the role of this enzyme in vivo.

How can researchers effectively design studies to explore the role of uppP in Azotobacter vinelandii nitrogen fixation?

Azotobacter vinelandii is particularly notable for its ability to fix nitrogen under aerobic conditions. Designing experiments to investigate the relationship between uppP function and nitrogen fixation requires multifaceted approaches:

  • Controlled expression systems:

    • Use of inducible promoters to modulate uppP expression levels

    • Creation of strains with varying uppP activity through partial suppression or overexpression

    • Monitor nitrogenase activity under different uppP expression conditions

  • Physiological assessment methods:

    • Acetylene reduction assays to quantify nitrogenase activity

    • ¹⁵N incorporation studies to measure nitrogen fixation efficiency

    • Respiratory protection assessment through oxygen consumption measurements

  • Stress response investigations:

    • Challenge with cell wall-targeting antibiotics while measuring nitrogen fixation

    • Comparative analysis of wild-type vs. uppP-modified strains under oxidative stress

    • Investigation of membrane integrity under nitrogen-fixing conditions

  • Environmental condition variables:

    • Oxygen tension variation to test respiratory protection mechanisms

    • Carbon source alterations to examine metabolic shifts

    • Metal ion availability manipulation, particularly molybdenum and iron

When designing these experiments, researchers should consider that A. vinelandii has evolved specialized respiratory protection mechanisms to shield nitrogenase from oxygen inactivation, including uncoupled respiration . Any impact of uppP modifications on cell envelope integrity could potentially affect these protective mechanisms.

How does the Azotobacter vinelandii uppP compare structurally and functionally with uppP enzymes from other bacterial species?

Comparative analysis of the A. vinelandii uppP with those from other bacterial species reveals important evolutionary and functional relationships:

  • Sequence conservation patterns:

    • The A. vinelandii uppP shares the conserved (E/Q)XXXE and PGXSRSXXT motifs found in most bacterial UPP phosphatases

    • Higher sequence similarity to other Gram-negative UPP phosphatases, particularly those from Pseudomonadaceae

    • Distinct from the PAP2 superfamily of UPP phosphatases found in many bacteria

  • Structural differences:

    • Membrane topology predictions suggest A. vinelandii uppP contains 6-8 transmembrane segments

    • The periplasmic orientation of the active site is consistent with E. coli UppP

    • Subtle differences in the substrate binding pocket may influence specificity for UPP with varied polyisoprenoid chain lengths

  • Functional characteristics:

    • Kinetic parameters comparison (table below)

    • Inhibitor sensitivity profiles

    • Metal ion dependence and pH optima

Bacterial SpeciesKm for UPP (μM)kcat (s⁻¹)Optimal pHDivalent Cation Requirement
A. vinelandii uppP35-45*2-5*7.5*Mg²⁺ or Ca²⁺*
E. coli UppP (BacA)30-403-77.0-7.5Mg²⁺
P. aeruginosa UppP25-354-87.5-8.0Mg²⁺
B. subtilis BcrC50-601-36.5-7.0Mn²⁺

*Estimated values based on homology with closely related enzymes; exact parameters for A. vinelandii uppP require experimental verification

These comparative insights can guide the development of selective inhibitors and inform engineering efforts for biotechnological applications specific to A. vinelandii uppP.

What recombination detection methods are suitable for analyzing evolutionary relationships between uppP variants across bacterial species?

For researchers interested in the evolutionary relationships between bacterial uppP variants, appropriate recombination detection methods (RDMs) must be selected based on sequence characteristics:

  • Recommended primary analysis methods:

    • PhiPack (Profile) for initial detection of recombination signals across sequence alignments

    • 3SEQ for detailed analysis of recombination events between sequence triplets

    • GENECONV for identification of gene conversion events between sequence pairs

  • Secondary validation methods:

    • MaxChi and Chimaera (implemented in OpenRDP) for confirmation of recombination breakpoints

    • RDP (implemented in OpenRDP) for broad detection of recombination signals

  • Analysis parameters based on uppP sequence characteristics:

    • For uppP sequences with moderate diversity (1-5% divergence), MaxChi provides appropriate sensitivity

    • For more divergent sequences (>5% divergence), GENECONV and 3SEQ offer greater precision

    • Window sizes of 20-30% of the total sequence length are recommended for sliding window analyses

  • Performance considerations:

    • For datasets with >100 uppP sequences, computing resource limitations may necessitate using more efficient methods like 3SEQ

    • Analysis of highly divergent sequences (>10% divergence) requires methods with appropriate correction for multiple substitutions

Recent evaluations of RDMs have shown that their performance varies considerably with sequence diversity levels . For uppP analysis specifically, researchers should employ multiple methods and consider consensus results as most reliable, particularly focusing on recombination events detected by both 3SEQ and GENECONV.

How can researchers employ structural biology approaches to elucidate the catalytic mechanism of Azotobacter vinelandii uppP?

Resolving the catalytic mechanism of A. vinelandii uppP requires integrated structural biology approaches:

  • Protein crystallization strategies:

    • Lipidic cubic phase (LCP) crystallization methods for membrane proteins

    • Fusion protein approaches (e.g., T4 lysozyme fusion) to increase polar surface area

    • Antibody fragment co-crystallization to stabilize flexible regions

    • Nanobody co-crystallization approaches

  • Alternative structural determination methods:

    • Cryo-electron microscopy (cryo-EM) for membrane protein structures

    • Nuclear magnetic resonance (NMR) for dynamic analyses of specific domains

    • Molecular dynamics simulations based on homology models to predict substrate binding

  • Mechanistic investigation through mutagenesis:

    • Alanine scanning of conserved motifs to identify essential residues

    • Conservative substitutions to probe specific chemical roles

    • Introduction of reporter groups for spectroscopic analyses

    • Cross-linking studies to map substrate binding sites

  • Enzymatic mechanism characterization:

    • pH-rate profiles to identify catalytic residues

    • Solvent isotope effects to probe transition states

    • Pre-steady-state kinetics to identify rate-limiting steps

    • Metal ion replacement studies to characterize the role of divalent cations

These approaches should be integrated with computational methods including quantum mechanics/molecular mechanics (QM/MM) simulations to develop a comprehensive model of the phosphate hydrolysis mechanism. The challenges of working with an integral membrane protein necessitate considering detergent solubilization strategies that maintain native-like lipid interactions while permitting structural studies.

How can understanding uppP function contribute to metabolic engineering of exopolysaccharide production in Azotobacter vinelandii?

Understanding and manipulating uppP function presents several strategic avenues for enhancing exopolysaccharide production in Azotobacter vinelandii:

  • UP pool optimization strategies:

    • Controlled overexpression of uppP to increase UP availability

    • Metabolic balancing of UPP synthesis and dephosphorylation

    • Engineering feedback regulation to coordinate UP recycling with exopolysaccharide synthesis demand

  • Alginate production enhancement:

    • Research has shown that A. vinelandii can produce alginate at industrially relevant levels, with the potential for 40% yield improvements through modified UP metabolism

    • Coordination of uppP expression with alginate biosynthetic gene clusters

    • Strategic mutations in regulatory elements like mucA, algW, and amrZ that control alginate production

  • Polymer quality control approaches:

    • Manipulation of UP availability can influence the mannuronic acid to guluronic acid ratio in alginate

    • Co-expression of uppP with specific mannuronan C-5 epimerases (AlgE2, AlgE4) can yield hybrid enzymes that introduce novel monomer sequence patterns

    • Engineering strain stability to maintain consistent exopolysaccharide composition

  • Process integration considerations:

    • Development of bioreactor strategies specific to engineered strains

    • Continuous extraction methodologies compatible with modified polymer characteristics

    • Integration with nitrogen fixation capabilities for reduced cultivation costs

The commercial potential for enhanced alginate production is substantial, with applications in wound healing, drug delivery, tissue engineering, and food industries. Strategic manipulation of uppP represents a fundamental approach to addressing the carrier lipid bottleneck that frequently limits polysaccharide biosynthesis rates.

What are common challenges in expressing and purifying recombinant Azotobacter vinelandii uppP and how can they be addressed?

Researchers commonly encounter several challenges when working with recombinant A. vinelandii uppP:

  • Low expression levels:

    • Challenge: As an integral membrane protein, uppP often expresses poorly in heterologous systems

    • Solutions:

      • Use specialized strains like C41(DE3) designed for membrane protein expression

      • Reduce induction temperature to 16-18°C

      • Optimize codon usage for the expression host

      • Consider fusion partners like MBP that can enhance folding and stability

  • Inclusion body formation:

    • Challenge: Overexpressed uppP may aggregate in inclusion bodies

    • Solutions:

      • Reduce expression rate through lower inducer concentrations

      • Add chemical chaperones (e.g., glycerol, arginine) to the growth medium

      • Co-express molecular chaperones (GroEL/ES, DnaK/J)

      • Consider native-like refolding protocols from solubilized inclusion bodies

  • Protein instability:

    • Challenge: Purified uppP may demonstrate limited stability

    • Solutions:

      • Include 10-20% glycerol in all buffers

      • Optimize detergent selection (screen DDM, LMNG, GDN, and others)

      • Add lipids to stabilize the purified protein (E. coli polar lipids or synthetic mixtures)

      • Perform all purification steps at 4°C with protease inhibitors

  • Enzymatic activity loss:

    • Challenge: Loss of activity during purification or storage

    • Solutions:

      • Verify proper orientation in reconstituted systems

      • Add reducing agents to prevent oxidation of essential residues

      • Reconstitute in liposomes or nanodiscs for long-term activity studies

      • Store concentrated protein (>1 mg/ml) in small aliquots at -80°C

These technical challenges have been successfully addressed in studies of related bacterial membrane proteins, including other phosphatases and transferases involved in lipid carrier recycling . Adapting these approaches to A. vinelandii uppP can significantly improve research outcomes.

How can researchers validate that recombinant Azotobacter vinelandii uppP maintains its native structure and function after purification?

Validating the native structure and function of recombinant uppP after purification is critical for reliable experimental outcomes. Multiple complementary approaches should be employed:

  • Functional validation approaches:

    • Enzyme activity assays using natural substrates when possible

    • Comparison of kinetic parameters with those reported for homologous enzymes

    • Inhibition profiles using known inhibitors of UPP phosphatases

    • Complementation of uppP-deficient bacterial strains

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure composition

    • Thermal stability assays (differential scanning fluorimetry) to evaluate folding

    • Size-exclusion chromatography to confirm monodispersity

    • Limited proteolysis to probe for correctly folded domains

  • Membrane protein-specific validations:

    • Detergent exchange experiments to identify optimal stabilizing conditions

    • Lipid-protein interaction studies using native lipid environments

    • Reconstitution into proteoliposomes with activity measurements

    • Assessment of orientation in membrane mimetic systems

  • Advanced biophysical characterization:

    • Isothermal titration calorimetry (ITC) to measure binding of substrate analogs

    • Microscale thermophoresis to evaluate ligand interactions

    • Hydrogen-deuterium exchange mass spectrometry to probe protein dynamics

    • Fluorescence spectroscopy to monitor conformational changes upon substrate binding

These validation approaches should be complementary, with activity assays serving as the primary confirmation of proper folding and function. When comparing to native enzyme parameters, researchers should account for potential differences due to detergent solubilization and the absence of the native membrane environment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.