Recombinant B-lymphotropic polyomavirus Minor capsid protein VP2

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
Minor capsid protein VP2; Minor structural protein VP2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-356
Protein Length
Full Length of Mature Protein
Species
B-lymphotropic polyomavirus (LPV)
Target Protein Sequence
GGVLSLLFNISEIAAELSLSTGFTVDAILTGEAFAAVSTEAAWLIEIEAVDLAGLSTLEA LSLTGLTTEQFSLLSAIPTALNNAIGIGVFFQTVSGASAVVAAGVTTFGYSKEVPVVNMA LVPWFPQVDYLFPGFTSFSYYLNAVLDWGESLFHAVGREVWRHLMRQATLQIGQATRAVA VRSTNELSHTLAQIAENARWALTSGPVHIYSSVQDYYRYLPARNPIQLRQEYRNRGEPPP SRADFEYQENREGQRARRELGYDEPRSGQYVEHYTAPGGAHQRVTQDWMLPLILGLYGDI TPTWEVELNKLEKEEDGPSKKKARRSMQKNMPYSRSRPQAPSKRRSRGARSKNRA
Uniprot No.

Target Background

Function

VP2, an isoform of the minor capsid protein in B-lymphotropic polyomavirus, is a structural protein residing within the capsid core, surrounded by 72 VP1 pentamers. It participates in host cell receptor binding in conjunction with VP1. Following viral endocytosis and transport to the endoplasmic reticulum (ER), VP2 and VP3 oligomerize and integrate into the ER membrane. The VP2-VP3 hetero-oligomer may function as a viroporin, facilitating viral genome transport across the ER membrane into the cytoplasm. Nuclear entry of the viral DNA involves the selective exposure and importin recognition of the VP2 or VP3 nuclear localization signal (shared C-terminus). VP2 plays a crucial role in virion assembly within the nucleus, particularly through a DNA-binding domain in its C-terminal region. N-terminal myristoylation suggests a scaffolding function in virion assembly. Viral progeny release occurs via lytic mechanisms. In summary, VP2 is a structural protein found in the capsid core, crucial for receptor binding, membrane integration, genome transport, and nuclear virion assembly. Isoform VP3 also contributes to virion assembly within the nucleus.

Database Links

KEGG: vg:1494440

Protein Families
Polyomaviruses capsid protein VP2 family
Subcellular Location
[Isoform VP2]: Virion. Host nucleus. Host endoplasmic reticulum. Host endoplasmic reticulum membrane.; [Isoform VP3]: Virion. Host nucleus. Host endoplasmic reticulum. Host endoplasmic reticulum membrane.

Q&A

What is the structural role of VP2 in polyomavirus capsids?

VP2 is a structural protein that resides within the core of the polyomavirus capsid, surrounded by 72 VP1 pentamers. It plays a critical role in maintaining capsid integrity while participating in host cell receptor binding together with VP1. The protein forms an essential internal scaffolding component that supports proper virion assembly . Research indicates that VP2 contains a DNA-binding domain located in the C-terminal region, which contributes to virion assembly within the nucleus . The structural position of VP2 allows it to interact with both the viral genome and the major capsid protein VP1, creating a stable virion architecture.

How does VP2 differ from VP3 and VP4 in polyomaviruses?

The distinctions between these capsid proteins are significant and impact viral function:

FeatureVP2VP3VP4
LocationCore of capsidCore of capsidNot in mature virion
SizeLarger proteinTruncated form of VP2Smallest
Expression timingEarly in assemblyEarly in assembly24h after structural proteins
N-terminal modificationMyristoylatedNo myristoylationNone
Function in infectionCritical for entry in many cell typesAssists in viral entryViroporin for cell lysis
PresenceAll polyomavirusesNot in all (e.g., absent in MCV)Limited presence

VP2 and VP3 share a common C-terminus containing nuclear localization signals, but VP2 has a unique N-terminal region that can be myristoylated . Interestingly, not all polyomaviruses encode VP3, with Merkel cell polyomavirus (MCV) being a notable example of a VP3-less polyomavirus . VP4 functions as a viroporin that induces perforation of cellular membranes, forming pores of approximately 3 nm inner diameter, but is not incorporated into the mature virion .

What experimental approaches can be used to study VP2 myristoylation?

VP2 myristoylation can be studied using Click-iT chemistry, a more efficient alternative to traditional tritiated substrate methods. The experimental procedure involves:

  • Transfecting cells with VP1 and VP2 expression plasmids

  • Metabolically labeling cells with myristic acid derivatized with an azide group

  • Extracting pseudovirions from the cells

  • Reacting the extracted material with a TAMRA fluorochrome linked to an alkyne

  • Performing SDS-PAGE followed by in-gel fluorescent detection

  • Comparing with total protein staining of the same gel

This technique leverages the highly specific copper-catalyzed reaction between azide and alkyne groups, enabling clear visualization of myristoylated proteins. Research has confirmed that polyomavirus VP2 is myristoylated at the glycine residue at position two of the protein sequence, with mutation of this residue (e.g., G2V, G2S, or G2F) reducing viral infectivity by approximately 10-fold in certain cell lines .

How does VP2 contribute to cell-specific tropism of polyomaviruses?

VP2's role in polyomavirus tropism is complex and cell-type dependent. Research demonstrates that VP2 facilitates a post-attachment stage of infectious entry into some cell types but is dispensable for others . This differential requirement suggests that:

  • In cells where VP2 is beneficial, there exists a specific barrier to entry that VP2 helps overcome

  • In cells like UACC-62 or SK-MEL-2 (melanoma lines), which VP1-only pseudoviruses transduce efficiently, this barrier appears not to exist or is not encountered during infection

Experimental evidence shows dramatic differences in VP2 dependence across cell lines:

  • 293TT cells (kidney-derived): Strong VP2-dependent infectivity

  • NCI/ADR-RES cells (ovarian cancer): Enhanced transduction with high VP2 levels

  • A549 cells (lung cancer): Moderate VP2 enhancement of infectivity

  • UACC-62 and SK-MEL-2 cells (melanoma): Minimal effect of VP2 on infectivity

This cell-type specificity suggests that VP2 interacts with cellular factors that vary between tissue types, potentially explaining the varied tissue tropism observed among polyomaviruses in vivo.

What molecular mechanisms underlie VP2-VP3 hetero-oligomerization and viroporin formation?

Following viral endocytosis and trafficking to the endoplasmic reticulum, VP2 and VP3 form oligomers and integrate into the endoplasmic reticulum membrane . This hetero-oligomerization is believed to create a viroporin structure that facilitates transporting the viral genome across the endoplasmic reticulum membrane to the cytoplasm . The molecular mechanisms involve:

  • Conformational changes in the capsid during trafficking that expose VP2/VP3

  • Insertion of hydrophobic domains into host membranes

  • Formation of organized oligomeric structures creating pore-like channels

  • Selective transport of viral DNA through these channels

The precise stoichiometry and structural organization of these VP2-VP3 viroporins remain areas of active investigation. Research techniques including cryo-electron microscopy, cross-linking mass spectrometry, and targeted mutagenesis would help elucidate the exact molecular architecture of these structures.

How does the DNA damage response (DDR) pathway interact with VP2 during polyomavirus infection?

Recent research has uncovered a critical link between the mismatch repair (MMR) pathway, DNA damage response (DDR), and VP2 during polyomavirus infection. Key findings include:

  • BK polyomavirus infection upregulates components of the MutSα complex (including Msh6)

  • The mismatch repair pathway is important for DDR activation during polyomavirus infection

  • Inhibiting the DDR reduces viral titers by generating less infectious virions that lack VP2

  • VP2 deficiency affects viral trafficking, suggesting DDR activation influences VP2 synthesis or incorporation

This relationship represents a potential vulnerability in the viral life cycle that could be therapeutically exploited. Inhibition of specific DDR components might selectively reduce VP2 incorporation into virions, thereby attenuating viral spread without directly targeting viral proteins. This approach could be particularly valuable for developing antivirals against polyomavirus infections in immunocompromised patients .

What are optimal approaches for producing recombinant polyomavirus VP2 proteins?

Recombinant production of polyomavirus VP2 can be achieved through several expression systems, with yeast being a well-documented host . The methodological considerations include:

Expression SystemAdvantagesLimitationsApplications
Yeast (e.g., S. cerevisiae)Post-translational modifications, High yieldHyperglycosylation may occurStructural studies, antibody production
Mammalian cellsNative folding, Proper myristoylationHigher cost, Lower yieldFunctional studies, Interaction analyses
Bacterial systemsHigh yield, Cost-effectiveLack of PTMs, Inclusion bodiesAntigen production, Linear epitope studies
Baculovirus/insect cellsHigher-order assembly, PTMsModerate costVirus-like particle production

For functional studies requiring myristoylation, mammalian expression systems are preferred since they contain the necessary N-myristoyltransferases. When producing VP2 for structural studies without functional requirements, yeast systems (as used for the commercially available recombinant protein) provide good yields with some post-translational modifications .

How can researchers effectively generate and analyze VP2 mutants to study function?

Generation and analysis of VP2 mutants requires careful experimental design:

  • Mutation strategy:

    • Site-directed mutagenesis targeting key residues (e.g., G2X mutations in myristoylation site)

    • Truncation mutants to identify functional domains

    • Alanine-scanning mutagenesis for systematic functional mapping

  • Expression and purification:

    • Co-expression with VP1 if studying capsid incorporation

    • Differential centrifugation and density gradient purification for virion/pseudovirion studies

    • Affinity tags for biochemical purification (with validation that tags don't disrupt function)

  • Functional analysis methods:

    • Pseudovirus transduction assays comparing wild-type and mutant VP2

    • Fluorescence microscopy for intracellular trafficking studies

    • Co-immunoprecipitation to assess protein-protein interactions

    • Click chemistry for myristoylation analysis

Research with MCV has demonstrated that mutations in the VP2 myristoylation motif (G2V, G2S, G2F) reduce infectivity by approximately 10-fold in 293TT cells, whereas complete VP2 knockout reduces infectivity by 20-30 fold . Such comparative quantification allows for assessment of the relative importance of specific residues or domains.

What techniques are most effective for studying VP2 interaction with host cellular components?

Investigation of VP2's interactions with host factors can employ multiple complementary techniques:

  • Proximity-based interaction studies:

    • BioID or TurboID proximity labeling

    • APEX2-based proximity labeling

    • Cross-linking mass spectrometry (XL-MS)

  • Direct binding assays:

    • Co-immunoprecipitation followed by mass spectrometry

    • Yeast two-hybrid screening

    • Protein microarray scanning

  • Functional interaction studies:

    • siRNA/CRISPR screens to identify host dependency factors

    • Competitive inhibition assays

    • Subcellular fractionation and co-localization analyses

  • In situ visualization:

    • FRET/BRET to detect protein-protein interactions

    • Super-resolution microscopy for co-localization

    • Live-cell imaging to track dynamic interactions

These approaches can reveal how VP2 engages with cellular machinery during different stages of infection. For example, research shows VP2 requires co-expression with VP1 for efficient nuclear localization, suggesting VP1-VP2 interactions affect subcellular targeting . Additionally, the differential requirement for VP2 across cell types indicates cell-specific factors that interact with VP2 during entry .

What is the evolutionary significance of VP2 conservation across polyomavirus species?

Evolutionary analysis reveals important patterns in VP2 conservation:

  • VP2 is conserved across all known polyomaviruses, while VP3 is absent in some species (including MCV) , suggesting VP2 serves essential functions that cannot be fully compensated by other viral proteins.

  • Interestingly, VP3-less viruses encode larger VP1 proteins than those found in most VP3-positive species, suggesting potential functional compensation through VP1 expansion .

  • Nuclear localization signal (NLS) distribution varies between VP3-positive and VP3-less polyomaviruses:

    • VP3-less species encode an NLS near the N-terminus of VP1 and lack an NLS within VP2

    • Nearly all VP3-positive species have a predicted NLS near the C-terminus of VP2

    • About half of VP3-positive species do not contain a predicted NLS within VP1

  • Overlapping coding regions for the N-terminus of VP1 and C-terminus of VP2 may have facilitated evolutionary transfer of functions between these proteins through frameshift mutations or tandem duplications .

This evolutionary pattern suggests that while VP2 remains essential, its functions may be partially redistributed among viral proteins during evolution, potentially explaining the conditional requirement for VP2 in different cell types.

How can recombinant VP2 be utilized in developing novel diagnostics for polyomavirus infections?

Recombinant VP2 offers several advantages for diagnostic development:

  • Serological assays:

    • ELISA-based tests using purified VP2 to detect antibodies

    • Multiplex serological assays incorporating VP2 from different polyomavirus species

    • Conformational epitope preservation for detecting neutralizing antibodies

  • Molecular probes:

    • Fluorescently labeled VP2 for detecting cellular receptors/co-factors

    • VP2-based affinity reagents for enriching viral particles from clinical samples

    • Competitive binding assays to measure neutralizing activity

  • Cell-based diagnostics:

    • Reporter systems based on VP2-dependent infection pathways

    • Cell lines expressing VP2 for antibody validation

    • Functional assays to detect VP2-targeting antibodies

  • Technical advantages:

    • Recombinant production in yeast systems provides good yield and stability

    • Defined molecular weight (40.2 kDa) facilitates quality control

    • Ability to introduce tags or mutations for specialized applications

These diagnostic applications could be particularly valuable for monitoring polyomavirus infections in immunocompromised populations, where early detection and intervention are critical.

What are common challenges in working with recombinant polyomavirus VP2?

Researchers may encounter several challenges when working with VP2:

  • Solubility issues: The hydrophobic domains that enable VP2 to interact with membranes can cause aggregation and precipitation during expression and purification.

  • Myristoylation heterogeneity: When expressed in heterologous systems, VP2 may exhibit variable levels of N-terminal myristoylation, affecting functional studies.

  • Structural instability: In the absence of VP1, VP2 may not maintain its native conformation, complicating structural studies.

  • Cell type variability: As demonstrated in pseudovirus studies, VP2's role varies dramatically between cell types, potentially leading to inconsistent results if cell models aren't carefully selected .

  • Viral context dependency: Some functions of VP2 may only be observable in the context of complete virions or during actual infection.

  • Antibody specificity: The overlapping sequence with VP3 and potential conformational epitopes can complicate development of VP2-specific antibodies.

Solutions include co-expression with VP1 to improve stability, careful choice of expression systems to ensure proper myristoylation, inclusion of appropriate detergents or membrane mimetics, and validation across multiple cell types.

How should researchers validate the functionality of recombinant VP2 preparations?

Comprehensive validation of recombinant VP2 requires multiple approaches:

  • Biochemical validation:

    • SDS-PAGE to confirm molecular weight (40.2 kDa)

    • Western blotting with VP2-specific antibodies

    • Mass spectrometry to verify sequence and modifications

    • Click chemistry to confirm myristoylation status

  • Structural validation:

    • Circular dichroism to assess secondary structure

    • Limited proteolysis to verify folding

    • Thermal shift assays to evaluate stability

    • Electron microscopy of VP2-VP1 co-assemblies

  • Functional validation:

    • Binding assays with VP1 and nucleic acids

    • Membrane integration assays

    • Pseudovirus complementation studies

    • Cell entry assays in VP2-dependent cell lines

  • Comparative validation:

    • Side-by-side testing with virus-derived VP2

    • Comparison across different expression systems

    • Testing against known VP2 mutants as controls

A systematic approach incorporating these validation steps ensures that recombinant VP2 preparations accurately reflect the properties of native viral VP2, enabling reliable experimental outcomes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.