Recombinant Bacillus amyloliquefaciens ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees will apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; RBAM_034010; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-170
Protein Length
full length protein
Species
Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / FZB42) (Bacillus amyloliquefaciens subsp. plantarum)
Target Names
atpF
Target Protein Sequence
MSQLPLELGLSFNGGDILFQLLAMLVLLALLKKFALGPLLNIMKQREDHIAGEITSAEER NKEAQKLIEEQRVLLKEAKQESQSLIENAKKLGEKQKEDIIQAARAESERLKEAARTEIV KEKEQAVSALREQVASLSVLIASKVIEKELDEQAQEQLIQDYLKEVGESR
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core, and the F0 domain, containing the membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. This protein is a component of the F0 channel and forms part of the peripheral stalk, connecting F1 and F0.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the structural and functional role of ATP synthase subunit b (atpF) in Bacillus species?

ATP synthase subunit b (atpF) is a critical component of the bacterial F-type ATP synthase complex that plays an essential role in cellular energy production. In Bacillus species, including B. amyloliquefaciens, this subunit forms part of the membrane-embedded F₀ region of the ATP synthase . Structurally, subunit b works together with subunit a to enable the core functions of proton translocation across the membrane . The F₀ region, containing subunits a and b, provides the structural framework necessary for proton movement through the membrane, which drives the rotational catalysis in the F₁ region where ATP synthesis occurs .

Unlike more complex mitochondrial ATP synthases, bacterial ATP synthases such as those in Bacillus species have a simpler subunit composition but perform the same essential function of coupling proton translocation to ATP production . The atpF gene encodes subunit b, which forms a critical stator element that connects the membrane F₀ domain to the catalytic F₁ domain, providing stability during rotation of the central stalk during ATP synthesis.

How does oxidative phosphorylation in Bacillus amyloliquefaciens compare to other Bacillus species?

Oxidative phosphorylation in B. amyloliquefaciens shows similarities to other Bacillus species but with distinctive metabolic characteristics. B. amyloliquefaciens possesses a highly efficient tricarboxylic acid cycle metabolic flux that contributes to its energy production capabilities . This efficiency makes it particularly useful for biotechnological applications, including the production of value-added compounds like γ-polyglutamic acid and L-ornithine .

In contrast to what has been observed in B. subtilis, where deletion of components of the restriction-modification system (particularly BsuMI methylation modification) leads to decreased expression of cytochrome oxidase subunits and weakened oxidative phosphorylation , B. amyloliquefaciens maintains robust ATP production. Studies have demonstrated that B. amyloliquefaciens can accumulate significant levels of intracellular ATP (up to 3.2 μmol/g) when certain metabolic pathways are modified, such as when polyglutamate synthase genes (pgsBCA) are knocked out . This ATP accumulation capability suggests a resilient oxidative phosphorylation system that can be leveraged for metabolic engineering applications.

What are the optimal methods for cloning the atpF gene from Bacillus amyloliquefaciens?

For successful cloning of the atpF gene from B. amyloliquefaciens, researchers should follow this methodological approach:

  • Primer Design: Design primers based on the conserved regions of the atpF gene. For B. amyloliquefaciens, primers should be designed using the published genome sequence (similar to NC_017190.1 referenced for B. amyloliquefaciens in the literature) . Include appropriate restriction sites for subsequent cloning steps.

  • PCR Amplification: Use high-fidelity DNA polymerase for PCR amplification of the atpF gene from genomic DNA. Optimize PCR conditions including annealing temperature, extension time, and magnesium concentration.

  • Cloning Strategy: Employ either traditional restriction enzyme-based cloning or more efficient one-step cloning methods like the ClonExpress II system, as used successfully for cloning other genes from B. amyloliquefaciens .

  • Vector Selection: Choose an expression vector with an appropriate promoter for heterologous expression. For Bacillus genes, vectors containing the T7 promoter system have been used successfully when expressing in E. coli hosts .

  • Verification: Confirm the correct sequence by colony PCR and Sanger sequencing, as described in previous research with B. amyloliquefaciens genes .

For researchers working with difficult-to-amplify regions, overlapping PCR strategies might be necessary, similar to those used for gene knockout constructions in B. amyloliquefaciens .

What expression systems are most effective for producing recombinant B. amyloliquefaciens atpF?

Based on successful approaches with similar bacterial membrane proteins, the following expression systems are recommended for recombinant B. amyloliquefaciens atpF:

E. coli Expression Systems:

  • The T7 promoter-based expression system in E. coli BL21(DE3) has proven effective for expressing ATP synthase components from Bacillus species . This system has been successfully used to express the complete ATP synthase from Bacillus PS3 in E. coli, suggesting its suitability for B. amyloliquefaciens atpF .

  • For membrane proteins like atpF, using specialized E. coli strains such as C41(DE3) or C43(DE3), which are designed to better tolerate membrane protein overexpression, may improve yields.

Homologous Expression:

  • Expression within B. subtilis, a close relative of B. amyloliquefaciens, can provide advantages for proper folding and incorporation into membranes. The CRISPR/Cas9 double plasmids system, as used for genetic modifications in B. amyloliquefaciens, can be adapted for controlled expression .

Key Expression Parameters:

  • Temperature: Lower induction temperatures (16-25°C) typically improve folding of membrane proteins

  • Inducer concentration: Optimize IPTG concentration (typically 0.1-0.5 mM) for balanced expression

  • Growth media: Enriched media formulations support higher biomass and protein yields

What purification strategies yield high-purity recombinant atpF protein?

Purification of recombinant atpF protein requires strategies optimized for membrane proteins:

Membrane Extraction:

  • Harvest cells and lyse using either sonication or high-pressure homogenization

  • Separate membrane fraction by ultracentrifugation (typically 100,000×g for 1 hour)

  • Solubilize membranes using appropriate detergents such as n-dodecyl-β-D-maltoside (DDM), which has been successful for ATP synthase purification

Affinity Chromatography:

  • Incorporate a polyhistidine tag (His-tag) at either N- or C-terminus for immobilized metal affinity chromatography (IMAC)

  • For ATP synthase components, nickel-nitrilotriacetic acid (Ni-NTA) resin has proven effective

  • Include detergent in all purification buffers to maintain protein solubility

Additional Purification Steps:

  • Size exclusion chromatography to remove aggregates and achieve higher purity

  • Ion exchange chromatography as a polishing step

Quality Assessment:

  • SDS-PAGE analysis to confirm purity

  • Western blotting with antibodies against the His-tag or specific antibodies against atpF

  • Mass spectrometry for definitive identification

This purification approach has been successful for obtaining high-resolution structural information on bacterial ATP synthases, as demonstrated with Bacillus PS3 ATP synthase .

How do mutations in the atpF gene affect ATP synthase assembly and function in B. amyloliquefaciens?

Mutations in the atpF gene can have profound effects on ATP synthase assembly and function in B. amyloliquefaciens, with consequences for cellular energetics and metabolism. Based on studies of ATP synthase in related bacteria, the following patterns emerge:

Critical Functional Domains:

  • The N-terminal transmembrane domain anchors subunit b in the membrane and provides structural stability

  • The C-terminal domain interacts with the F₁ sector (α and β subunits) and is essential for the stator function

  • The central region provides flexibility required during the catalytic cycle

Effects of Specific Mutations:

Mutation RegionObserved EffectsMetabolic Consequences
Transmembrane domainImpaired membrane insertion, destabilized F₀ complexReduced proton translocation, lower ATP synthesis
F₁-interaction domainDisrupted connection between F₀ and F₁ sectorsUncoupled ATP synthesis from proton gradient
Dimerization interfacePrevented proper stator formationInstability during rotation, reduced efficiency

When ATP synthase function is compromised due to atpF mutations, cellular adaptations are observed similar to those in B. subtilis with altered oxidative phosphorylation components. These adaptations include shifts toward glycolytic ATP generation and altered expression of cytochrome oxidase subunits . Notably, such changes might impact competence formation and transformation efficiency, as observed in B. subtilis strains with modifications to their oxidative phosphorylation pathway .

Research indicates that compromised ATP synthase function forces redistribution of cellular energy resources, potentially resulting in metabolic shifts similar to those observed in engineered B. amyloliquefaciens strains with modified glutamate metabolism and ATP allocation .

What methods are most effective for studying protein-protein interactions between atpF and other ATP synthase subunits?

Several complementary methods have proven effective for investigating protein-protein interactions between atpF (subunit b) and other ATP synthase components:

Structural Methods:

  • Cryo-Electron Microscopy: This technique has revolutionized our understanding of ATP synthase structure, allowing visualization of the intact complex at near-atomic resolution (3.0-3.2 Å for Bacillus PS3 ATP synthase) . This approach reveals the spatial positioning of subunit b relative to other subunits in different rotational states.

  • Cross-linking Mass Spectrometry (XL-MS): This method identifies interaction sites between subunits by chemically cross-linking proteins in their native state, followed by mass spectrometric analysis. Different cross-linkers with varying spacer lengths can probe the distance constraints between subunits.

Biochemical Methods:

  • Co-immunoprecipitation: Using antibodies against atpF or epitope tags to pull down interacting partners.

  • Bacterial Two-Hybrid Systems: Adapting two-hybrid approaches for membrane proteins to detect specific interactions between atpF and other ATP synthase components.

Genetic Methods:

  • Suppressor Analysis: Introducing second-site mutations that restore function in atpF mutants to identify interacting regions.

  • Site-Directed Mutagenesis: Systematically introducing mutations at predicted interaction interfaces to assess their impact on complex formation and function.

Computational Methods:

  • Molecular Dynamics Simulations: Modeling the dynamic interactions between atpF and other subunits based on structural data.

  • Coevolution Analysis: Identifying coevolving residues between atpF and other subunits, which often indicate interaction interfaces.

The combination of cryo-EM structural analysis with biochemical and genetic approaches has proven particularly powerful for understanding the architecture and assembly of bacterial ATP synthases .

How can recombinant B. amyloliquefaciens atpF be utilized in metabolic engineering applications?

Recombinant B. amyloliquefaciens atpF can be strategically utilized in metabolic engineering applications to enhance cellular energetics and improve production of valuable compounds:

ATP Homeostasis Optimization:
Modifying atpF expression can fine-tune ATP synthesis rates, allowing redistribution of cellular energy resources toward desired metabolic pathways. This approach is particularly valuable in strains engineered for high-value product synthesis where ATP availability is a limiting factor . For instance, in B. amyloliquefaciens strains engineered for L-ornithine production, ensuring optimal ATP levels through carefully balanced ATP synthase activity could complement the already observed 4.5-fold increase in ATP levels achieved through pgsBCA knockout .

Enhancing Stress Tolerance:
Engineered variants of atpF could improve ATP synthase stability under stressful fermentation conditions (temperature fluctuations, pH changes), potentially increasing productivity and strain robustness during industrial fermentation processes.

Integration with Existing Metabolic Engineering Strategies:
Recombinant atpF modifications can be combined with established metabolic engineering approaches in B. amyloliquefaciens:

Engineering StrategyRole of Modified atpFExpected Outcome
Pathway optimizationFine-tuned ATP supplyBalanced energy for biosynthetic pathways
Precursor enhancementCoordinated energy productionSynchronized supply of energy and precursors
Transporter overexpressionEnhanced energetics for transportImproved product export and reduced feedback inhibition

For example, when engineering B. amyloliquefaciens for L-ornithine production, researchers achieved significant improvement by modulating precursor pathways and transporters . Complementing these strategies with optimized ATP synthase function through recombinant atpF could further enhance production capabilities by ensuring adequate energy supply for these engineered pathways.

What techniques are available for analyzing the structure and conformation of recombinant atpF?

Researchers have several sophisticated techniques at their disposal for analyzing the structure and conformation of recombinant atpF:

High-Resolution Structural Analysis:

  • Cryo-Electron Microscopy (Cryo-EM): This technique has revolutionized our understanding of membrane protein complexes including ATP synthase. For Bacillus ATP synthase, cryo-EM has achieved resolutions of 3.0-3.2 Å, allowing construction of nearly complete atomic models . This approach can reveal how atpF interacts with other subunits in different rotational states.

  • X-ray Crystallography: While challenging for membrane proteins, this technique can provide atomic-level resolution of protein structure when crystals can be obtained. Often used for soluble domains of membrane proteins.

  • Nuclear Magnetic Resonance (NMR) Spectroscopy: Useful for studying smaller domains or fragments of atpF in solution, providing information about dynamic properties and conformational changes.

Spectroscopic Methods:

  • Circular Dichroism (CD) Spectroscopy: Provides information about secondary structure content (α-helices, β-sheets) and can monitor structural changes under different conditions.

  • Fluorescence Spectroscopy: Using intrinsic tryptophan fluorescence or site-specific labeling to monitor conformational changes in atpF.

Computational Approaches:

  • Molecular Dynamics Simulations: Can model the behavior of atpF in a membrane environment, predicting conformational flexibility and interaction potential.

  • Homology Modeling: Building structural models based on the resolved structures of homologous proteins, such as the subunit b from Bacillus PS3 ATP synthase .

Biochemical Methods:

  • Limited Proteolysis: Identifying flexible or exposed regions of the protein that are accessible to proteases.

  • Cross-linking Studies: Using chemical cross-linkers to capture native protein conformations and identify proximity relationships.

The structural analysis of bacterial ATP synthases has been particularly advanced by cryo-EM, which has allowed visualization of the complete complex in multiple rotational states and revealed the detailed architecture of the proton-conducting pathway .

How does the subunit composition of ATP synthase in B. amyloliquefaciens differ from other bacterial species?

The ATP synthase of B. amyloliquefaciens shares the core architecture of bacterial F-type ATP synthases but exhibits species-specific characteristics:

Core Subunit Composition:
The B. amyloliquefaciens ATP synthase, like other bacterial ATP synthases, contains the basic subunit composition of:

  • F₁ sector: α₃β₃γδε

  • F₀ sector: ab₂c₈-15

This composition is simpler than the mitochondrial ATP synthase but performs the same fundamental function of coupling proton translocation to ATP synthesis .

Comparative Analysis of ATP Synthase Subunits:

SubunitB. amyloliquefaciens CharacteristicsComparison to Other Bacteria
Subunit aContains loops that fill roles performed by additional subunits in mitochondrial enzymes Similar to other Bacillus species, differs from E. coli in specific residues in the proton channel
Subunit b (atpF)Forms part of the stator stalkStructural differences from E. coli ATP synthase
Subunit εInhibits ATP hydrolysis while allowing synthesisPosition varies between Bacillus and E. coli enzymes
c-ringLikely contains 10 c subunits (based on other Bacillus species)Varies in different bacteria (8-15 c subunits)

The detailed structural analysis of Bacillus PS3 ATP synthase revealed that loops in subunit a perform functions that require additional subunits in more complex mitochondrial ATP synthases . This architectural difference demonstrates how the simpler bacterial ATP synthase achieves the same core functions as its more complicated mitochondrial counterpart.

Additionally, the structure of the bacterial enzyme reveals specific pathways for proton translocation that have been the subject of extensive mutagenesis studies . These structural insights provide a framework for understanding the functional significance of specific residues in the ATP synthase complex.

What are the challenges in obtaining functionally active recombinant atpF and how can they be overcome?

Producing functionally active recombinant atpF presents several challenges due to its nature as a membrane protein and its role in a multi-subunit complex:

Major Challenges and Solutions:

  • Membrane Insertion and Folding

    • Challenge: As a membrane protein, atpF requires proper insertion into membranes for correct folding

    • Solution: Use specialized E. coli strains (C41/C43) designed for membrane protein expression; lower induction temperature (16-20°C); consider addition of membrane-mimetic environments during purification

  • Toxicity to Expression Host

    • Challenge: Overexpression of membrane proteins can disrupt host membrane integrity

    • Solution: Use tightly regulated promoters; optimize inducer concentration; consider using bacterial strains with reduced membrane protein expression toxicity

  • Protein Stability

    • Challenge: Isolated atpF may be unstable outside its native complex

    • Solution: Express with partner subunits (particularly subunit a); optimize detergent selection; include stabilizing lipids during purification

  • Functional Assessment

    • Challenge: Difficult to assess functionality when isolated from the ATP synthase complex

    • Solution: Develop reconstitution systems with other ATP synthase subunits; employ binding assays with known interaction partners

Experimental Strategy for Functional atpF Production:

  • Co-expression with interacting partners (particularly other F₀ components)

  • Optimization of growth and induction conditions (temperature, inducer concentration, media composition)

  • Screening multiple detergents for extraction and purification

  • Including phospholipids during purification to maintain native-like environment

  • Developing functional assays to verify proper folding and activity

Using approaches similar to those that enabled successful structural studies of Bacillus PS3 ATP synthase would be valuable, as these resulted in ATP synthase complexes that retained their structure and function through expression in E. coli and subsequent purification .

How can B. amyloliquefaciens ATP synthase be targeted for antimicrobial development?

The ATP synthase of B. amyloliquefaciens represents a promising antimicrobial target due to its essential role in bacterial energy metabolism. Strategic approaches for targeting this complex include:

Target Validation and Rationale:
ATP synthase is essential for cellular energetics, particularly under aerobic conditions. Its inhibition can lead to energy depletion and bacterial death. The structural differences between bacterial and human ATP synthases provide a basis for selective targeting . B. amyloliquefaciens ATP synthase, like other bacterial F-type ATP synthases, has a simpler subunit composition compared to mitochondrial enzymes, offering unique structural elements that can be selectively targeted .

Targeting Strategies:

  • F₁ Catalytic Site Inhibitors:

    • Design competitive inhibitors that bind to catalytic sites on β subunits

    • Screen for compounds that lock the enzyme in specific rotational states, preventing catalytic cycle completion

  • F₀ Proton Channel Blockers:

    • Develop molecules that obstruct the proton translocation pathway identified in bacterial ATP synthases

    • Target the unique loops in subunit a that are specific to bacterial enzymes

  • Interface Disruptors:

    • Design peptides or small molecules that disrupt critical interfaces between atpF and other subunits

    • Target the stator function of subunit b, which is essential for the mechanical coupling of F₁ and F₀ sectors

Screening Methodologies:

  • Structure-based virtual screening utilizing the atomic models of bacterial ATP synthases

  • Biochemical assays measuring ATP synthesis/hydrolysis activities

  • Whole-cell assays assessing effects on bacterial growth and survival

  • Membrane potential assays to detect disruption of proton gradient utilization

Selectivity Considerations:
Focus development on compounds that exploit structural differences between bacterial and human ATP synthases to minimize toxicity to host cells. The unique architecture of bacterial ATP synthase, particularly in the membrane region, provides opportunities for selective targeting .

What is the relationship between ATP synthase function and genetic competence in Bacillus species?

The interplay between ATP synthase function and genetic competence in Bacillus species represents a fascinating area of research with implications for genetic engineering and transformation protocols:

Observed Correlations:
Studies in B. subtilis have revealed that reducing ATP synthesis through repressed oxidative phosphorylation actually promotes competence formation . Specifically, deletion of the BsuMI methylation modification group resulted in decreased expression of cytochrome oxidase subunits, weakening the oxidative phosphorylation pathway . This metabolic shift enhanced glycolytic activity and improved the distribution of ATP molecules into competence formation .

Mechanistic Explanations:

  • ATP Distribution Theory:
    When oxidative phosphorylation is weakened, the cell redirects ATP resources toward processes that enhance survival, including competence formation for potential genetic acquisition .

  • Energy Sensing Mechanisms:
    The competence regulatory network appears sensitive to cellular energetic status, potentially through ATP-dependent transcription factors or signaling pathways.

  • Metabolic State Influence:
    The shift from respiratory to fermentative metabolism under conditions of reduced oxidative phosphorylation creates a physiological state more conducive to DNA uptake and transformation.

Practical Applications:
These insights have led to successful genetic engineering strategies. For example, researchers constructed a B. subtilis 168-R⁻M⁻ strain (without its native restriction-modification system) that achieved 63-fold improvement in plasmid transformation efficiency compared to control strains . This transformation platform demonstrates enhanced universality across Bacillus species .

Research Implications:
Understanding the relationship between ATP synthase function and competence provides opportunities to develop improved transformation protocols for difficult-to-transform Bacillus strains, including B. amyloliquefaciens. Targeted modifications of ATP synthase components or regulators may offer new strategies for enhancing genetic competence in industrially important Bacillus strains.

How can site-directed mutagenesis of atpF be used to study ATP synthase function?

Site-directed mutagenesis of atpF provides a powerful approach for dissecting the structure-function relationships within the ATP synthase complex:

Key Regions for Mutagenesis Analysis:

  • Transmembrane Domain:

    • Mutations in membrane-spanning regions can reveal requirements for proper membrane insertion and stability

    • Alterations to specific residues can test their role in interactions with other membrane subunits (particularly subunit a)

  • Stator Function:

    • Mutations in the regions that connect to the F₁ sector can elucidate the mechanical coupling between proton translocation and ATP synthesis

    • Altering the rigidity or flexibility of connecting regions can reveal their importance in energy transmission

  • Dimerization Interface:

    • Since subunit b typically functions as a dimer, mutations at the dimerization interface can assess the importance of this interaction

Experimental Design for Mutagenesis Studies:

Mutation TypeTarget ResiduesFunctional AssaysExpected Insights
Alanine scanningConserved residues across domainsATP synthesis/hydrolysis, proton pumpingIdentify essential residues
Conservative substitutionsCharged/polar residues in interfacesSubunit association, complex stabilityRole in structural integrity
Non-conservative substitutionsKey interaction sitesRotational mechanics, enzyme kineticsContribution to catalytic mechanism
Deletion mutationsFlexible regionsAssembly of F₁F₀ complexImportance of specific segments

Analytical Approaches:

  • Enzymatic assays measuring ATP synthesis/hydrolysis activities

  • Proton pumping assays using pH-sensitive fluorescent probes

  • Structural analysis of mutant complexes using cryo-EM

  • Molecular dynamics simulations to predict effects of mutations

The high-resolution structures of bacterial ATP synthases provide an excellent framework for designing informed mutagenesis experiments . The ability to visualize the complex in different rotational states allows researchers to target residues with specific roles in the catalytic cycle .

What are the differences in expression regulation of atpF between B. amyloliquefaciens and other Bacillus species?

The regulation of atpF expression in B. amyloliquefaciens exhibits both conserved and distinctive features compared to other Bacillus species:

Regulatory Elements and Mechanisms:

  • Promoter Architecture:
    While specific data on B. amyloliquefaciens atpF regulation is limited in the provided search results, ATP synthase genes in Bacillus species are typically organized in the atp operon, which is under the control of coordinated regulatory mechanisms responding to energy status and growth phase.

  • Energy-Sensing Mechanisms:
    In B. subtilis, the expression of oxidative phosphorylation components is responsive to cellular energy status, with observed downregulation of these genes under certain conditions, such as deletion of restriction-modification systems . B. amyloliquefaciens likely shares similar energy-sensing regulatory mechanisms but may exhibit species-specific responses based on its metabolic capabilities.

  • Growth Phase Regulation:
    Expression patterns of ATP synthase components typically vary with growth phase, with highest expression during exponential growth when energy demands are greatest.

Comparative Expression Analysis:

ConditionB. amyloliquefaciens ResponseComparison to B. subtilis
Carbon source availabilityAdapted to efficient utilization of inulin Less efficient with some non-preferred carbon sources
Oxygen limitationLikely rapid adaptation of respiratory componentsDocumented shifts in cytochrome expression
Metabolic engineering contextMaintains robust ATP levels when key pathways are modified Similar adaptability observed

Biotechnological Implications:
Understanding the regulatory mechanisms controlling atpF expression in B. amyloliquefaciens can inform metabolic engineering strategies. For example, the robust ATP production capabilities observed in engineered B. amyloliquefaciens strains (with ATP levels increasing 4.5-fold after pgsBCA deletion) suggest adaptable energy metabolism regulation that can be leveraged for biotechnological applications.

Research Approaches:

  • Transcriptome analysis comparing atpF expression across different growth conditions

  • Promoter-reporter fusion studies to identify regulatory elements

  • Comparative genomics examining conservation of regulatory regions across Bacillus species

  • Transcription factor binding studies to identify specific regulators

How does the proton translocation pathway in B. amyloliquefaciens ATP synthase compare to other bacterial species?

The proton translocation pathway in B. amyloliquefaciens ATP synthase likely shares fundamental features with other Bacillus species while possessing unique characteristics:

Structural Features of the Proton Pathway:
Based on high-resolution structural studies of Bacillus PS3 ATP synthase, which provides the best model for understanding Bacillus ATP synthases, the proton translocation pathway involves specific structural elements :

  • a-c Subunit Interface: The primary site of proton movement occurs at the interface between subunit a and the c-ring, where protons move from the periplasmic half-channel through the c-ring and into the cytoplasmic half-channel .

  • Essential Residues: Key charged residues in both subunit a and the c-subunits form the proton pathway and determine specificity.

  • Architectural Simplicity: The bacterial ATP synthase achieves proton translocation with a simpler subunit composition compared to mitochondrial complexes, utilizing unique loops in subunit a to perform functions that require additional subunits in more complex ATP synthases .

Comparative Analysis:

FeatureB. amyloliquefaciens (predicted)Bacillus PS3E. coli
c-ring compositionLikely 10 c-subunits10 c-subunits10 c-subunits
Key residues in a-subunitConserved arginineConserved arginineArginine 210
Half-channel architectureLikely similar to Bacillus PS3Revealed by cryo-EM structures Differences in specific residues
Proton:ATP ratioPredicted 3.3H⁺:1ATP3.3H⁺:1ATP3.3H⁺:1ATP

Functional Implications:
The specific architecture of the proton translocation pathway determines the efficiency of ATP synthesis and the sensitivity to environmental conditions such as pH and membrane potential. The high-resolution structures of bacterial ATP synthases have revealed the path of proton translocation and provided models for understanding decades of biochemical analysis on the roles of specific residues .

Research Approaches:

  • Site-directed mutagenesis of predicted key residues

  • Proton pumping assays using pH-sensitive fluorescent probes

  • Structural analysis using cryo-EM to resolve B. amyloliquefaciens-specific features

  • Computational modeling of proton movement through the predicted pathway

Understanding the species-specific characteristics of the proton translocation pathway could inform targeted modifications for biotechnological applications or antimicrobial development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.