Recombinant Bacillus amyloliquefaciens Cadmium, cobalt and zinc/H (+)-K (+) antiporter

Shipped with Ice Packs
In Stock

Description

Functional Role in Heavy Metal Resistance

Comparative genomic analyses of B. amyloliquefaciens strains (e.g., Bam1 and FZB42) highlight CzcD's contribution to metal tolerance:

StrainMetal Resistance Profile (MIC, µg/mL)Key Genes Involved
Bam1Cd²⁺: 512; Zn²⁺: 1024; Co²⁺: 256czcD, cadA
FZB42Cd²⁺: 64; Zn²⁺: 256; Co²⁺: 64czcD (lower activity)

Key Findings:

  • Cadmium resistance: Deletion of czcD in strain Bam1 reduced Cd²⁺ MIC by 16-fold, underscoring its role in Cd²⁺ efflux .

  • Zinc and cobalt: CzcD works synergistically with CadA (a P-type ATPase) to export Zn²⁺ and Co²⁺, particularly under high metal concentrations .

  • Non-essential metals: CzcD also mitigates toxicity from non-essential metals like Pb²⁺ through non-specific export .

Genomic Context

  • DNA islands: czcD is located within genomic islands in B. amyloliquefaciens Bam1, flanked by mobile genetic elements that enhance horizontal gene transfer .

  • Prophage associations: Unlike strain FZB42, Bam1 retains prophage regions encoding auxiliary metal-resistance genes .

Expression Profiles

  • Induction under stress: Transcriptomic data show czcD upregulation by 12-fold under Cd²⁺ stress, compared to 3-fold in Zn²⁺-exposed cells .

  • Regulatory interplay: CzcD expression is modulated by Fur (for Fe²⁺ homeostasis) and Zur (for Zn²⁺ regulation) .

Biotechnological Applications

  • Bioremediation: Recombinant B. amyloliquefaciens strains overexpressing CzcD demonstrate enhanced Cd²⁺ removal from contaminated soils (up to 80% efficiency in lab-scale trials) .

  • Agricultural use: Engineered strains improve plant growth under heavy metal stress by reducing metal uptake in rhizospheres .

Comparative Analysis with Homologs

FeatureB. amyloliquefaciens CzcDB. subtilis CzcD
Substrate rangeCd²⁺, Co²⁺, Zn²⁺Zn²⁺, Co²⁺
Regulatory mechanismCzrA-dependentArsR-dependent
Metal affinity (Kd)Cd²⁺: 0.2 µMZn²⁺: 0.5 µM

Note: B. amyloliquefaciens CzcD exhibits broader substrate specificity and higher Cd²⁺ affinity than homologs in related species .

Challenges and Future Directions

  • Engineering limitations: Overexpression of CzcD may disrupt ion homeostasis, requiring fine-tuned regulatory circuits .

  • Field applicability: Scaling recombinant strains for environmental use necessitates stability tests under variable pH and salinity .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us for preferential development.
Synonyms
czcD; RBAM_005600; Cadmium, cobalt and zinc/H(+-K(+ antiporter
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-313
Protein Length
full length protein
Species
Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / FZB42) (Bacillus amyloliquefaciens subsp. plantarum)
Target Names
czcD
Target Protein Sequence
MGHNHNHAGGSNKKVLLISFIMITGYMIIEAIGGFLTNSLALLSDAGHMLSDSISLMVAL IAFKLAEKKASHHKTFGYKRFEILAAVINGVALILISLYIIYEAIKRFSHPPEVATTGML TISIIGLAVNILVAWIMLNGGDTKNNLNIRGAYLHVISDMLGSIGAILAAILIIFFGWSW ADPAASVIVAILVLRSGYHVTKDSIHVLMEGTPGNIDVTDIIHTIEETEGIQSIHDLHIW SITSGLNALSCHAVVNDQLTISESESILRKIEHELGDKGITHVTIQMETAAHNHDNTILC QSQTENPRDHHHH
Uniprot No.

Target Background

Function

This protein is involved in divalent cation and potassium homeostasis within cells. It catalyzes the active efflux of zinc, cadmium, and cobalt in exchange for potassium and H+ ions.

Database Links
Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.