Recombinant Bacillus amyloliquefaciens Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Biochemical Role and Mechanism

Lgt catalyzes the transfer of a diacylglyceryl moiety from phosphatidylglycerol to the conserved cysteine residue in prolipoproteins, initiating their maturation and membrane anchoring . This lipid modification is essential for:

  • Membrane localization: Lipoproteins require diacylglyceryl anchors for integration into bacterial membranes .

  • Signal peptidase II (Lsp) activity: Unlike in Escherichia coli, B. amyloliquefaciens Lgt-independent Lsp activity has been observed, suggesting species-specific processing mechanisms .

Key Functional Domains

Conserved Motif/ResidueRole in CatalysisSource Organism
Y26, N146, G154Essential for enzymatic activityE. coli
Lgt signature motifPeriplanar-facing catalytic siteListeria monocytogenes

Production and Purification

Recombinant B. amyloliquefaciens Lgt is produced using heterologous expression systems, with parameters optimized for yield and purity :

Production Parameters

Host SystemPurity (SDS-PAGE)Gene NameApplication
E. coli≥85%lgtBiochemical studies
Yeast/Baculovirus≥85%lgtStructural analysis
Mammalian Cells≥85%lgtFunctional assays

CRISPR-based genetic toolkits in B. amyloliquefaciens enable efficient gene editing (93% knockout efficiency) and strain optimization for high-yield enzyme production .

A. Biotechnological Applications

  • Antimicrobial development: Lgt is a validated drug target in Mycobacterium tuberculosis due to its essential role in virulence .

  • Protein secretion systems: Engineered B. amyloliquefaciens strains with enhanced secretion cassettes (e.g., PamyQ-SPaprE) achieve high yields of recombinant proteins (e.g., 30,200 U/mL in fermenters) .

B. Metabolic Engineering

ModificationOutcomeReference
Deletion of Banpr25.4% increase in protease yield
Overexpression of lgtEnhanced lipoprotein retention

Comparative Analysis with Homologs

FeatureB. amyloliquefaciens LgtE. coli LgtMycobacterium Lgt
Host compatibilityBroad (E. coli, yeast)Membrane-boundEssential for viability
Lipoprotein releasePartial in Δlgt mutantsComplete lossComplete secretion
Industrial scalabilityHigh (fermenter yields)LimitedNot characterized

Future Directions

  • Drug discovery: Targeting Lgt in pathogenic bacteria could disrupt membrane integrity .

  • Synthetic biology: Optimizing B. amyloliquefaciens as a chassis for lipoprotein-based vaccine production .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate this in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during the production process. If you have specific tag type preferences, please inform us, and we will prioritize development of the specified tag.
Synonyms
lgt; RBAM_032180; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / FZB42) (Bacillus amyloliquefaciens subsp. plantarum)
Target Names
lgt
Target Protein Sequence
MNEAGTPINPIAFQLGPLSVHWYGIIIGAGALLGLWMAMRESEKRGLKKDIFIDLVLFAI PIAIICARAYYVLFEWSYYSEHPGEIIKIWKGGIAIHGGLIGAIATGIVFSKVRGISFWK LADIAAPSILLGQAIGRWGNFINQEAHGEAVSRSFLESLHLPDFIINQMYIDGQYYHPTF LYESLWSFAGVVILLLLRRVNLRRGNLFLTYVIWYSIGRYFIEGMRTDSLMLTSQLRIAQ VISIVLIVLAIILMIFRRMKGYADKRYADTD
Uniprot No.

Target Background

Function
Prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein Diacylglyceryl Transferase (Lgt) and what is its function in Bacillus amyloliquefaciens?

Prolipoprotein diacylglyceryl transferase (Lgt) in Bacillus amyloliquefaciens catalyzes the first step in bacterial lipoprotein biosynthesis, attaching a diacylglyceryl moiety from phosphatidylglycerol to the thiol group of the conserved +1 position cysteine via a thioether bond in preprolipoproteins. This modification is essential for proper lipoprotein processing and localization. In Gram-positive bacteria like B. amyloliquefaciens, lipoproteins typically remain anchored to the cytoplasmic membrane after modification, where they perform various functions including nutrient acquisition, signal transduction, and cell envelope maintenance .

The enzyme recognizes preprolipoproteins containing a signal peptide followed by a conserved four amino acid sequence known as a lipobox ([LVI][ASTVI][GAS]C), which are secreted through the membrane via Sec or Tat pathways. Following Lgt-mediated diacylglyceryl transfer, the signal peptide is cleaved by lipoprotein signal peptidase (LspA), resulting in mature lipoproteins that can properly function in the cell envelope . This lipid modification is crucial for maintaining membrane integrity and proper cellular function in B. amyloliquefaciens.

How can efficient knockout or knockdown systems for lgt be designed in B. amyloliquefaciens?

Designing efficient knockout or knockdown systems for the lgt gene in B. amyloliquefaciens requires careful consideration of several methodological approaches. For targeted gene knockout, CRISPR-Cas9 systems adapted for B. amyloliquefaciens can be employed, using guide RNAs specifically designed to target the lgt coding sequence. When designing the knockout construct, researchers should consider including selectable markers and homology arms flanking the lgt gene to facilitate homologous recombination .

For conditional knockout or knockdown approaches (preferable if lgt is essential), inducible systems can be implemented. A CRISPRi approach, similar to that described for E. coli, could be adapted for B. amyloliquefaciens, utilizing a catalytically inactive Cas9 (dCas9) and guide RNAs targeting the lgt promoter or coding region . The level of gene downregulation should be carefully optimized, as demonstrated in E. coli where partial downregulation of lgt expression sensitizes cells to Lgt inhibitors without completely preventing growth .

Verification of knockout or knockdown efficiency should include quantitative PCR to measure lgt transcript levels, Western blotting to detect Lgt protein, and functional assays to assess lipoprotein processing, such as monitoring the accumulation of unprocessed prolipoproteins as demonstrated in E. coli systems .

What methods can be used to detect and quantify Lgt activity in B. amyloliquefaciens?

Detection and quantification of Lgt activity in B. amyloliquefaciens can be approached using several complementary methodologies:

Biochemical activity assay: The most direct approach involves measuring the release of glycerol phosphate as a byproduct of the Lgt-catalyzed transfer of diacylglyceryl from phosphatidylglycerol to a peptide substrate. As demonstrated for E. coli Lgt, this can be accomplished using a peptide substrate derived from a known lipoprotein (e.g., containing the conserved lipobox sequence) and a coupled enzymatic assay to detect either glycerol-1-phosphate (G1P) or glycerol-3-phosphate (G3P) . The detection can be coupled to a luciferase reaction for high sensitivity, as illustrated in the following reaction scheme:

  • Lgt catalyzes: Phosphatidylglycerol + Peptide-Cys → Diacylglyceryl-Peptide-Cys + Glycerol phosphate

  • Glycerol phosphate is detected via coupled enzymatic reactions leading to a luminescent output

Western blot analysis: Indirect measurement of Lgt activity can be performed by monitoring the processing state of known B. amyloliquefaciens lipoproteins using Western blot. Different forms of lipoproteins (unprocessed prolipoproteins, diacylglyceryl-modified prolipoproteins, and mature lipoproteins) can be distinguished by their electrophoretic mobility .

SDS fractionation: As demonstrated in E. coli studies, SDS fractionation can separate peptidoglycan-associated proteins from non-peptidoglycan-associated proteins, allowing for the assessment of lipoprotein processing and localization as an indirect measure of Lgt activity .

What are the optimal expression systems for producing recombinant B. amyloliquefaciens Lgt?

For optimal expression of recombinant B. amyloliquefaciens Lgt, several expression systems can be considered, each with specific advantages depending on research objectives:

Homologous expression in B. amyloliquefaciens: This approach maintains the native environment for Lgt function and is particularly suitable for functional studies. Key considerations include:

  • Promoter selection: Strong inducible promoters like P43 or PsrfA can be used to control expression levels

  • Signal peptide optimization: For proper membrane targeting

  • Selection of appropriate B. amyloliquefaciens strain: Preferably protease-deficient strains to minimize degradation

Expression in E. coli: For structural studies or high-yield protein production, E. coli expression systems offer advantages:

  • Use of specialized E. coli strains (e.g., C41/C43) designed for membrane protein expression

  • Fusion tags (such as His6, MBP, or SUMO) to enhance solubility and facilitate purification

  • Codon optimization for E. coli usage may improve expression levels

  • Consideration of C43(DE3) strain which has been successful for expressing membrane proteins from Gram-positive bacteria

Expression in other Bacillus species: B. subtilis could serve as an alternative host with similar cellular machinery:

  • Leveraging the extensive genetic toolbox available for B. subtilis

  • Using strong promoters like P_spac or P_xyl for controlled expression

  • Employing strains with reduced protease activity

The expression construct should ideally include a C-terminal affinity tag to avoid interference with the N-terminal processing and membrane insertion of Lgt. For membrane protein purification, detergent screening (e.g., DDM, LDAO, OG) would be necessary to identify conditions that maintain Lgt in a folded, active state .

How does B. amyloliquefaciens Lgt contribute to the organism's potential as a heterologous protein production host?

B. amyloliquefaciens has emerged as a valuable host for heterologous protein production, with its Lgt enzyme playing both direct and indirect roles in this capability. As a GRAS (Generally Recognized As Safe) organism with excellent protein secretion capacity, B. amyloliquefaciens offers several advantages for industrial protein production .

Lgt contributes to these capabilities through multiple mechanisms:

  • Membrane integrity maintenance: By ensuring proper lipoprotein processing, Lgt helps maintain cell envelope integrity, which is crucial for sustaining high-density fermentation and robust growth characteristics needed for industrial production .

  • Secretion apparatus functionality: Many components of protein secretion machinery interact with or depend on properly processed lipoproteins. Lgt's proper functioning ensures these interactions occur correctly, supporting the excellent intrinsic protein production capability of B. amyloliquefaciens .

  • Stress resistance: Properly processed lipoproteins contribute to stress resistance, allowing B. amyloliquefaciens to withstand the challenges of high-density fermentation conditions used in industrial protein production .

  • Processing of recombinant lipoproteins: For certain applications, heterologous proteins may need to be expressed as lipoproteins. Lgt would directly process these proteins when they contain appropriate signal sequences and lipoboxes .

The efficiency of B. amyloliquefaciens in producing heterologous proteins exceeds that of other Bacillus species in some cases. For example, when expressing alpha amylase from Pyrococcus furiosus, production in B. amyloliquefaciens was reported to be 3000-fold higher than in B. subtilis . This dramatic difference suggests that the unique characteristics of B. amyloliquefaciens, including potentially its lipoprotein processing machinery, may offer specific advantages for certain heterologous proteins.

What purification protocols are most effective for recombinant B. amyloliquefaciens Lgt?

Purifying recombinant B. amyloliquefaciens Lgt presents challenges typical of membrane proteins, requiring specialized protocols to maintain protein integrity and activity. An effective purification strategy would typically include:

Membrane extraction and solubilization:

  • Cell lysis using methods that preserve membrane protein structure (e.g., French press, sonication with cooling)

  • Membrane fraction isolation via differential centrifugation

  • Systematic detergent screening to identify optimal solubilization conditions

    • Mild detergents like DDM (n-dodecyl-β-D-maltopyranoside) or LDAO (lauryldimethylamine oxide) are good starting points

    • Detergent concentration optimization to maximize Lgt extraction while maintaining activity

Affinity chromatography:

  • If the recombinant Lgt includes an affinity tag (e.g., His6), immobilized metal affinity chromatography (IMAC) can be used

  • Buffer composition optimization to maintain protein stability:

    • Including glycerol (10-20%) to stabilize the protein

    • Adding phospholipids to maintain native-like environment

    • Controlling salt concentration to reduce non-specific interactions

Secondary purification:

  • Size exclusion chromatography to separate monomeric Lgt from aggregates

  • Ion exchange chromatography for further purification if necessary

Quality control assessments:

  • SDS-PAGE and Western blotting to verify purity

  • Enzyme activity assays using synthetic peptide substrates and measuring glycerol phosphate release

  • Circular dichroism to assess proper folding

Throughout the purification process, maintaining a detergent concentration above the critical micelle concentration is crucial to prevent protein aggregation. Additionally, all buffers should be supplemented with protease inhibitors to prevent degradation of the target protein during purification .

How can the substrate specificity of B. amyloliquefaciens Lgt be characterized?

Characterizing the substrate specificity of B. amyloliquefaciens Lgt requires a multi-faceted approach combining in vitro biochemical assays with in vivo validation:

Peptide library screening:

  • Design a library of synthetic peptides based on known lipobox motifs ([LVI][ASTVI][GAS]C)

  • Systematically vary amino acids at each position of the lipobox and in flanking regions

  • Assess Lgt activity toward each peptide using the glycerol phosphate release assay

  • Create a position-specific scoring matrix to quantify preferences at each position

Structural analysis of enzyme-substrate interactions:

  • If structural data becomes available, perform molecular docking simulations with various substrate peptides

  • Identify key residues in the Lgt active site that interact with specific substrate positions

  • Validate through site-directed mutagenesis of these key residues

In vivo validation using reporter systems:

  • Design constructs with varying lipobox sequences fused to a reporter protein

  • Express these constructs in wild-type and Lgt-depleted B. amyloliquefaciens

  • Assess lipidation efficiency through membrane fractionation and Western blotting

  • Correlate in vivo lipidation efficiency with in vitro activity measurements

Comparative analysis with other bacterial Lgt enzymes:

  • Compare substrate preferences of B. amyloliquefaciens Lgt with well-characterized Lgt enzymes from other bacteria

  • Identify unique features of B. amyloliquefaciens Lgt substrate recognition

This comprehensive approach would provide a detailed profile of B. amyloliquefaciens Lgt substrate specificity, potentially revealing unique characteristics that could be exploited for biotechnological applications or antimicrobial development .

What in vitro assay systems can be developed to study inhibitors of B. amyloliquefaciens Lgt?

Developing robust in vitro assay systems for studying inhibitors of B. amyloliquefaciens Lgt would provide valuable tools for both fundamental research and potential antimicrobial discovery. Based on approaches used with E. coli Lgt, the following assay systems can be adapted:

Primary biochemical assay:

  • Reaction components: Purified recombinant B. amyloliquefaciens Lgt, phosphatidylglycerol substrate, and synthetic peptide containing the lipobox motif

  • Detection method: Measure glycerol phosphate release using a coupled enzyme system linked to luciferase for luminescence readout

  • Reaction conditions: Optimize buffer composition, pH, temperature, and detergent concentration

  • Controls: Include negative controls (mutated peptide lacking the conserved cysteine) and positive controls (known Lgt inhibitors if available)

The detection system can be configured as follows:
Lgt: Phosphatidylglycerol + Peptide-CysDiacylglyceryl-Peptide-Cys + Glycerol-3-phosphate\text{Lgt: Phosphatidylglycerol + Peptide-Cys} \rightarrow \text{Diacylglyceryl-Peptide-Cys + Glycerol-3-phosphate}
G3P + O2 + other reagentscoupled enzymatic reactionsLuminescent signal\text{G3P + O}_2 \text{ + other reagents} \xrightarrow{\text{coupled enzymatic reactions}} \text{Luminescent signal}

Binding assays for inhibitor screening:

  • Thermal shift assays to identify compounds that stabilize Lgt structure

  • Surface plasmon resonance (SPR) to measure direct binding of potential inhibitors

  • Microscale thermophoresis (MST) as an alternative binding measurement approach

Secondary assays for validation:

  • Mass spectrometry-based assays to directly detect lipidated peptide products

  • Competition assays using fluorescently labeled substrate analogs

  • Membrane-based reconstitution systems to more closely mimic the native environment

Correlation with cellular effects:

  • Compare in vitro inhibition with effects on B. amyloliquefaciens growth

  • Assess accumulation of unprocessed prolipoproteins in treated cells

  • Evaluate membrane integrity changes upon inhibitor treatment

This multi-layered approach would enable the identification and characterization of B. amyloliquefaciens Lgt inhibitors, providing insights into both the enzyme's mechanism and potential applications in antimicrobial development .

How can B. amyloliquefaciens Lgt research contribute to the development of novel antimicrobials?

Research on B. amyloliquefaciens Lgt has significant potential to contribute to novel antimicrobial development through several avenues:

Target validation and inhibitor development:
Lgt represents a promising antibacterial target that has been validated in E. coli, where inhibitors demonstrated potent bactericidal activity . By extending this research to B. amyloliquefaciens Lgt, researchers can explore whether this enzyme represents a viable target in Gram-positive bacteria as well. Unlike inhibitors of later steps in lipoprotein biosynthesis, Lgt inhibitors have shown a unique advantage: deletion of major lipoproteins like Lpp does not confer resistance, suggesting a potentially lower propensity for resistance development .

Comparative studies for broad-spectrum applications:
Comparing the structure, function, and inhibitor susceptibility of Lgt across different bacterial species (including B. amyloliquefaciens) could facilitate the development of broad-spectrum antimicrobials targeting conserved features of this enzyme. Differences in inhibitor sensitivity between Gram-positive and Gram-negative Lgt enzymes could be exploited to develop targeted antimicrobials for specific bacterial classes .

B. amyloliquefaciens as a screening platform:
Given its GRAS status and genetic tractability, B. amyloliquefaciens could serve as an effective screening platform for Lgt inhibitors, allowing for both in vitro biochemical assays and whole-cell screening approaches . This could accelerate the discovery of compounds targeting Lgt across multiple bacterial species.

Structure-based drug design:
Structural characterization of B. amyloliquefaciens Lgt would enable structure-based approaches to inhibitor design, potentially leading to highly specific and potent antimicrobial compounds targeting this essential enzyme .

The pursuit of Lgt inhibitors represents a promising direction in antimicrobial research, particularly given the growing challenge of antimicrobial resistance and the need for novel antibacterial targets .

What role does Lgt play in optimizing B. amyloliquefaciens for heterologous protein production?

Understanding and potentially modifying Lgt activity in B. amyloliquefaciens could significantly impact its capabilities as a heterologous protein production platform:

Engineering the cell envelope for enhanced secretion:
B. amyloliquefaciens is valued for its excellent protein secretion capacity, which depends partly on properly functioning lipoproteins in the cell envelope . Strategic modification of Lgt activity could potentially enhance this secretion capacity by:

  • Optimizing the processing of lipoproteins involved in protein translocation

  • Reducing membrane stress during high-level protein secretion

  • Engineering the cell envelope for improved protein transit

Lipoprotein display technology:
Controlled Lgt-mediated lipidation could be exploited to develop surface display systems in B. amyloliquefaciens, where heterologous proteins are expressed as lipoproteins and anchored to the cell surface. This approach could be valuable for:

  • Whole-cell biocatalysts with surface-displayed enzymes

  • Vaccine development using B. amyloliquefaciens as a delivery platform

  • Biosensor development with surface-displayed receptor proteins

Strain engineering for enhanced production:
The remarkable production capabilities of B. amyloliquefaciens compared to other Bacillus species (e.g., 3000-fold higher production of alpha amylase compared to B. subtilis) suggest unique physiological characteristics that could be further enhanced . Fine-tuning Lgt activity could contribute to:

  • Improved cell envelope integrity during high-density fermentation

  • Enhanced stress tolerance during protein overproduction

  • Reduced proteolytic degradation of secreted proteins

Custom lipidation of heterologous proteins:
For certain applications, controlled lipidation of heterologous proteins might be desirable. Understanding B. amyloliquefaciens Lgt substrate specificity would enable rational design of constructs for this purpose, potentially leading to:

  • Enhanced stability of secreted proteins

  • Novel functionalities through membrane anchoring

  • Controlled cellular localization of heterologous proteins

These approaches align with the broader efforts to develop B. amyloliquefaciens as a sustainable, robust, and efficient microbial cell factory for heterologous protein production .

What are the major technical challenges in studying B. amyloliquefaciens Lgt?

Research on B. amyloliquefaciens Lgt faces several significant technical challenges that researchers must address:

Membrane protein expression and purification:
As a membrane-associated enzyme, Lgt presents inherent difficulties for biochemical and structural studies. Challenges include:

  • Achieving sufficient expression levels while avoiding toxicity

  • Identifying detergents that maintain enzyme stability and activity

  • Developing purification protocols that yield homogeneous, active protein

  • Preventing aggregation during concentration and storage

Development of specific activity assays:
Creating reliable, high-throughput assays for B. amyloliquefaciens Lgt activity requires:

  • Optimization of artificial substrate peptides that mimic natural B. amyloliquefaciens lipoproteins

  • Adaptation of glycerol phosphate detection methods for this specific enzyme

  • Establishing appropriate controls to ensure assay specificity

Genetic manipulation limitations:
While B. amyloliquefaciens is amenable to genetic manipulation, several challenges remain:

  • Lower transformation efficiency compared to model organisms like E. coli

  • Potential essentiality of lgt, necessitating conditional knockout approaches

  • Limited availability of well-characterized genetic tools compared to B. subtilis

Structural characterization:
Obtaining structural information on B. amyloliquefaciens Lgt presents significant challenges:

  • Difficulties in crystallizing membrane proteins

  • Challenges in expressing sufficient quantities for structural studies

  • Maintaining native conformation in detergent environments for structural analysis

Distinguishing strain-specific characteristics:
B. amyloliquefaciens encompasses multiple strains with potentially different Lgt characteristics:

  • Need for comparative studies across strains to identify common features

  • Challenges in translating findings from one strain to another

  • Limited genomic and proteomic data for some strains

Addressing these challenges will require interdisciplinary approaches combining molecular biology, biochemistry, structural biology, and bioinformatics to advance our understanding of this important enzyme.

How might CRISPR-based technologies be applied to study and modify Lgt function in B. amyloliquefaciens?

CRISPR-based technologies offer powerful approaches for studying and modifying Lgt function in B. amyloliquefaciens, with applications spanning from basic research to strain engineering:

Precise gene editing:
CRISPR-Cas9 systems can be adapted for B. amyloliquefaciens to create precise modifications to the lgt gene:

  • Introduction of point mutations to study structure-function relationships

  • Domain swapping with Lgt from other species to create chimeric enzymes

  • Promoter replacements to control expression levels

  • Introduction of affinity tags for purification without separate cloning steps

Conditional expression systems:
CRISPRi (CRISPR interference) provides a valuable tool for conditional knockdown of lgt expression:

  • Design of specific guide RNAs targeting the lgt promoter or coding sequence

  • Use of catalytically inactive Cas9 (dCas9) to repress transcription

  • Implementation of inducible systems to control the degree of repression

  • Creation of depletion strains to study the consequences of reduced Lgt activity

High-throughput functional genomics:
CRISPR-based approaches enable systematic studies of factors influencing Lgt function:

  • Genome-wide CRISPRi screens to identify genes affecting Lgt activity

  • Multiplexed editing to modify multiple pathway components simultaneously

  • Creation of reporter systems to monitor Lgt activity in vivo

Strain engineering for biotechnology:
CRISPR technologies can facilitate the creation of optimized B. amyloliquefaciens strains:

  • Precise tuning of Lgt expression levels to optimize protein production

  • Modification of Lgt substrate specificity through targeted mutagenesis

  • Engineering of synthetic lipoprotein processing pathways for novel applications

Base editing and prime editing:
Advanced CRISPR technologies could enable even more precise modifications:

  • Use of CRISPR base editors to introduce specific nucleotide changes without double-strand breaks

  • Application of prime editing for precise insertions, deletions, or substitutions in the lgt gene

The implementation of these technologies would require optimization for B. amyloliquefaciens, including appropriate promoters for Cas9/dCas9 expression, efficient guide RNA delivery methods, and protocols for selecting successfully edited cells .

What are the emerging research directions for B. amyloliquefaciens Lgt in synthetic biology applications?

Emerging research on B. amyloliquefaciens Lgt intersects with synthetic biology in several promising directions:

Engineered lipoprotein anchoring systems:
By understanding and modifying B. amyloliquefaciens Lgt substrate specificity, researchers could develop:

  • Programmable cell surface display platforms for enzymes and binding proteins

  • Multi-enzyme complexes anchored to the cell membrane via controlled lipidation

  • Synthetic membrane microdomains with defined lipoprotein composition

  • Orthogonal lipidation pathways for selective protein modification

Synthetic bacterial consortia:
Engineered B. amyloliquefaciens strains with modified Lgt could be incorporated into synthetic microbial communities:

  • Surface display of adhesion proteins to facilitate specific cell-cell interactions

  • Controlled release of bioactive proteins through regulated lipoprotein processing

  • Creation of structured biofilms with defined spatial organization

Cell-free expression systems:
Reconstituted lipoprotein biosynthesis pathways incorporating B. amyloliquefaciens Lgt could enable:

  • In vitro production of lipidated proteins for therapeutic applications

  • Development of biosensors utilizing lipidated receptor proteins

  • High-throughput screening platforms for Lgt inhibitors or substrate specificity

Minimal cell design:
Understanding the essential role of Lgt contributes to efforts in minimal cell design:

  • Defining the minimal set of lipoproteins required for B. amyloliquefaciens viability

  • Engineering simplified lipoprotein processing pathways

  • Creation of chassis strains with optimized membrane composition for specific applications

Cross-kingdom protein expression:
Exploiting B. amyloliquefaciens Lgt in heterologous contexts could enable:

  • Production of bacterial lipoproteins in eukaryotic expression systems

  • Engineering of hybrid membrane anchoring mechanisms combining features from different domains of life

  • Development of vaccine platforms utilizing bacterial lipoproteins as adjuvants

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.