Recombinant Bacillus amyloliquefaciens Protein psiE homolog (psiE)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of psiE

The psiE homolog in B. amyloliquefaciens is a 138-amino acid protein (UniProt ID: A7Z6Z1) with a molecular weight of approximately 15.7 kDa . Key features include:

PropertyDetails
Amino Acid SequenceMRFSNNFKKAPYLLQALLNVCLFFLAIALSGLLISETWYIVQFVYKSLFNKVDSYYEMLG... (138 aa)
Secondary StructurePredicted α-helical and β-sheet motifs, common in bacterial signaling proteins .
Conserved DomainsHomology to Bacillus subtilis psiE (yrkR), involved in stress response .

Expression Systems

  • Host Organism: E. coli is the primary host for psiE production, enabling high-yield soluble expression .

  • Vector Design: The gene is cloned under a T7 promoter with a His-tag fusion system .

Fermentation Optimization

  • Modular Engineering: Deletion of sporulation-related genes (e.g., sigF) in B. amyloliquefaciens increases heterologous protein yield by 25.3% .

  • Promoter Screening: Strong promoters like P43 from B. subtilis enhance transcription and protein secretion .

Purification Protocol

  • Chromatography: Immobilized metal affinity chromatography (IMAC) is used for His-tag purification .

  • Purity: >90% as confirmed by SDS-PAGE .

ParameterSpecification
FormLyophilized powder
Storage-20°C/-80°C in Tris/PBS buffer with 6% trehalose (pH 8.0)
Reconstitution0.1–1.0 mg/mL in sterile water, with 50% glycerol for long-term stability .

Functional Insights

While the exact biological role of psiE in B. amyloliquefaciens remains understudied, homologs in related species suggest involvement in:

  • Stress Response: Regulation during nutrient deprivation or environmental stress .

  • Cell Signaling: Potential interaction with sporulation-associated sigma factors (e.g., SigF) .

Industrial Use Cases

  • Enzyme Engineering: psiE serves as a model for optimizing secretion pathways in Bacillus spp. .

  • Biocatalysis: Fusion tags (e.g., His-tag) facilitate protein crosslinking studies .

Limitations

  • Proteolytic Degradation: Endogenous proteases in Bacillus spp. necessitate strain engineering (e.g., knockout of aprE, nprE) .

  • Scalability: Fed-batch fermentation in 5-L bioreactors improves dissolved oxygen and yield .

Research Advancements

Recent studies highlight:

  • Multi-Modular Engineering: Combining sporulation control, protease deletion, and polysaccharide synthesis gene knockouts boosts psiE homolog production by 39.6% .

  • Comparative Transcriptomics: Temporal analysis identifies growth-phase-dependent expression patterns .

Future Directions

  • Functional Genomics: Elucidate psiE’s role in Bacillus stress adaptation.

  • Synthetic Biology: Develop psiE-based biosensors or secretion tags for industrial enzymes .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will prepare according to your request.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life depends on various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
psiE; RBAM_024070; Protein PsiE homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-138
Protein Length
full length protein
Species
Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / FZB42) (Bacillus amyloliquefaciens subsp. plantarum)
Target Names
psiE
Target Protein Sequence
MRFSNNFKKAPYLLQALLNVCLFFLAIALSGLLISETWYIVQFVYKSLFNKVDSYYEMLG ELLIFFMYFEFIALIIKYFKSDFHFPLRYFIYIGITAVIRLIIIDHDQAISTFWWAMAIL AMICAFFIVNRRNSVVEH
Uniprot No.

Target Background

Database Links
Protein Families
PsiE family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does the expression system for recombinant proteins typically work in B. amyloliquefaciens?

The expression of recombinant proteins in B. amyloliquefaciens typically utilizes plasmid-based systems similar to those described for alkaline protease (AprE) production. Methodologically, this involves transformation of competent B. amyloliquefaciens cells with methylated plasmids containing the gene of interest. For example, with AprE expression, researchers cultivate a single colony of the transformed strain in LB medium at 37°C and 220 rpm for 6-8 hours, followed by inoculation into fermentation medium containing appropriate antibiotics (such as 50 mg/L kanamycin) and incubation at 37°C and 220 rpm for up to 60 hours . This approach would likely be adaptable for psiE homolog expression, with specific modifications to promoter selection and culture conditions based on the protein's characteristics and expression requirements.

What are the key growth characteristics of B. amyloliquefaciens that might affect recombinant protein expression?

B. amyloliquefaciens TCCC11018 exhibits distinctive growth patterns that directly impact recombinant protein production. Growth typically stabilizes after 12 hours of cultivation, with peak cell numbers occurring around 8 hours before declining at 12 hours. Notably, this strain shows accelerated autolysis, particularly after 48 hours when total cell counts may drop to approximately 3.2 Log/cfu/mL . Unlike many other Bacillus species, B. amyloliquefaciens TCCC11018 does not form spores in late growth phases, which affects its stability in prolonged cultures. Extracellular protease activity typically peaks at 48 hours before declining at 60 hours. These characteristics suggest optimal harvest times for recombinant proteins would likely be around 36-48 hours post-inoculation, before significant autolysis occurs.

What expression vectors are most suitable for recombinant psiE homolog production in B. amyloliquefaciens?

For optimal expression of the psiE homolog in B. amyloliquefaciens, plasmid vectors similar to the pLY-3 system described for AprE expression represent suitable starting points . When designing the expression construct, researchers should consider:

  • Promoter selection: Strong constitutive promoters or inducible systems depending on whether continuous or controlled expression is desired

  • Signal peptide: Inclusion of an appropriate signal sequence if secretion of the protein is required

  • Codon optimization: Adaptation of the coding sequence to B. amyloliquefaciens codon usage preferences

  • Selection markers: Inclusion of appropriate antibiotic resistance genes (such as kanamycin resistance)

The transformation protocol should follow established methods, using methylated plasmids to transform competent B. amyloliquefaciens cells, with subsequent selection on appropriate antibiotic-containing media. Verification of successful transformation can be performed via PCR and sequencing of isolated plasmids from transformants.

How can the culture medium be optimized for maximum recombinant psiE homolog production?

Medium optimization for recombinant psiE homolog production in B. amyloliquefaciens should employ statistical experimental design methods similar to those used for other protein production systems. The recommended systematic approach includes:

  • Initial screening using Plackett-Burman design (PBD) to identify significant factors affecting protein production

  • Applying the steepest ascent method (SAM) to navigate toward the optimal experimental design space

  • Implementing central composite design (CCD) to determine precise optimal concentrations of the identified significant variables

Key variables to consider include carbon sources (glucose, glycerol), nitrogen sources (yeast extract, peptone, ammonium salts), mineral components (phosphates, magnesium, trace elements), and physical parameters (pH, temperature, dissolved oxygen). This statistical optimization approach typically results in 2-5 fold improvements in recombinant protein yields compared to non-optimized conditions.

What purification strategies are most effective for isolating recombinant psiE homolog from B. amyloliquefaciens cultures?

Purification of recombinant psiE homolog from B. amyloliquefaciens should begin with determining whether the protein is expressed intracellularly or secreted to the culture medium. For secreted proteins, the general methodology includes:

  • Cell removal: Centrifugation at 10,000 g for 10 minutes at 4°C to separate cells from culture supernatant

  • Concentration: Ammonium sulfate precipitation or ultrafiltration to concentrate proteins from the supernatant

  • Chromatography sequence:

    • Initial capture using affinity chromatography (if a tag was incorporated) or ion exchange chromatography

    • Intermediate purification using hydrophobic interaction chromatography

    • Polishing step using size exclusion chromatography

For intracellular proteins, cell disruption methods (sonication, homogenization, or enzymatic lysis) would be required before proceeding with similar chromatographic purification steps. Protein activity should be monitored throughout purification using appropriate enzymatic or binding assays specific to the psiE homolog's function.

How does modular cell engineering of B. amyloliquefaciens impact recombinant psiE homolog production?

Modular engineering approaches significantly enhance recombinant protein production in B. amyloliquefaciens. Based on research with other recombinant proteins, three critical modules should be considered when engineering strains for psiE homolog production:

  • Sporulation germination module (Module I): Deletion of sporulation-related genes, particularly sigF, can increase recombinant protein production by approximately 25.3% . This improvement likely results from redirecting cellular resources from sporulation to protein synthesis.

  • Extracellular protease synthesis module (Module II): Mutation of genes encoding native extracellular proteases reduces degradation of recombinant proteins. Combining this with Module I modifications has shown synergistic effects, increasing production by up to 36.1% .

  • Extracellular polysaccharide synthesis module (Module III): Mutation of the eps gene cluster (containing 17 genes involved in extracellular polysaccharide production) reduces medium viscosity and improves dissolved oxygen levels during fermentation .

When all three modules are engineered in combination, recombinant protein production can increase by approximately 39.6% compared to control strains . This integrated approach represents the current state-of-the-art for optimizing B. amyloliquefaciens as an expression host.

How can two-component signal transduction systems influence psiE homolog expression and function?

Two-component signal transduction systems likely play crucial roles in regulating psiE homolog expression in B. amyloliquefaciens, particularly if this protein is involved in stress responses. These systems typically consist of a sensor histidine kinase and a cognate response regulator . The histidine kinase senses environmental stimuli and autophosphorylates on a conserved histidine residue, followed by phosphoryl transfer to a conserved aspartate on the response regulator, which then mediates changes in gene expression .

For investigating psiE regulation, researchers should consider:

  • Identifying potential two-component systems that respond to relevant stressors (nutrient limitation, osmotic stress, etc.)

  • Analyzing phosphorelay pathways that might regulate psiE expression

  • Examining cross-talk between different signaling systems

Given that approximately 25% of all histidine kinases are hybrids containing receiver domains , researchers should explore whether psiE regulation involves direct two-component signaling or more complex phosphorelay mechanisms. Understanding these regulatory networks could enable precise control of psiE expression through environmental or genetic manipulation of these signaling pathways.

What bioinformatic approaches can identify functional domains and predict interactions of the psiE homolog?

Comprehensive bioinformatic analysis of the psiE homolog should employ multiple complementary approaches:

  • Sequence homology analysis: BLAST searches against well-characterized psiE proteins from model organisms like E. coli to establish evolutionary relationships

  • Domain prediction: Tools like Conserved Domain Database (CDD), InterPro, and PFAM to identify functional domains and structural motifs

  • Structural prediction: AlphaFold2 or RoseTTAFold to generate predicted 3D structures that can inform function

  • Interaction network analysis: STRING database and co-expression data to predict protein-protein interactions

  • Genomic context analysis: Examination of neighboring genes and operonic structures to infer functional associations

The integration of these computational approaches provides a foundation for hypothesis generation regarding the specific functions of the psiE homolog in B. amyloliquefaciens and guides subsequent experimental validation through targeted mutagenesis, protein-protein interaction studies, or transcriptomic analysis under various stress conditions.

What are the most common challenges in expressing recombinant psiE homolog and how can they be addressed?

ChallengePotential CausesSolutions
Low expression levelsWeak promoter, poor codon optimization, protein toxicityTest multiple promoters, optimize codons for B. amyloliquefaciens, use inducible systems
Protein degradationNative proteases, improper foldingEngineer strains with reduced protease activity (Module II modifications), optimize culture conditions, use protease inhibitors
Insoluble protein formationRapid expression, improper foldingLower induction temperature, co-express chaperones, fusion with solubility tags
Growth inhibitionMetabolic burden, protein toxicityOptimize induction timing, balance protein expression with cell growth, use weaker promoters
Low secretion efficiencySignal peptide issues, cell wall limitationsTest multiple signal peptides, reduce extracellular polysaccharide production (Module III modifications)

For recombinant psiE homolog expression specifically, researchers should pay particular attention to the timing of expression relative to the growth phase of B. amyloliquefaciens, as the natural autolysis occurring after 48 hours could significantly impact protein yields .

How can fermentation conditions be optimized for scaled-up production of recombinant psiE homolog?

Scaling up recombinant psiE homolog production from shake flasks to bioreactors requires careful optimization of multiple parameters:

  • Dissolved oxygen: Critical for B. amyloliquefaciens growth and protein production; can be improved by reducing extracellular polysaccharide production through Module III engineering

  • Feeding strategy: Implement fed-batch fermentation with controlled nutrient feeding based on:

    • Growth rate

    • Dissolved oxygen demand

    • Metabolic byproduct accumulation

  • pH control: Maintain optimal pH (typically 7.0-7.5) using automated acid/base addition

  • Temperature profile: Consider temperature shifts during production phase (often reducing from 37°C to 30°C) to balance growth and protein production

  • Induction timing: Optimize based on growth curve characteristics, typically initiating production at early stationary phase

Laboratory-scale parameter optimization can be performed in 5-L bioreactors before scaling to production volumes . Statistical design of experiments (DoE) approaches should be employed to efficiently identify optimal parameter combinations and potential interaction effects among variables.

What analytical methods are most appropriate for characterizing the structure and function of purified psiE homolog?

Comprehensive characterization of purified psiE homolog requires multiple analytical approaches:

  • Structural analysis:

    • Circular dichroism (CD) spectroscopy for secondary structure content

    • Nuclear magnetic resonance (NMR) or X-ray crystallography for high-resolution structure

    • Mass spectrometry for protein mass confirmation and post-translational modifications

  • Functional analysis:

    • Activity assays based on predicted function (e.g., phosphate sensing)

    • Binding studies with potential interaction partners

    • Thermal shift assays to evaluate stability under various conditions

  • Biophysical characterization:

    • Size-exclusion chromatography with multi-angle light scattering (SEC-MALS) for oligomeric state determination

    • Isothermal titration calorimetry (ITC) for thermodynamic binding parameters

    • Surface plasmon resonance (SPR) for kinetic interaction analysis

The specific assays should be tailored to the predicted function of the psiE homolog, which might involve phosphate signaling, stress response, or other cellular processes based on homology to known psiE proteins in other bacterial species.

How can systems biology approaches enhance our understanding of psiE homolog function in B. amyloliquefaciens?

Systems biology approaches offer powerful frameworks for elucidating psiE homolog function within the broader cellular context of B. amyloliquefaciens. Integrated methodologies should include:

  • Comparative transcriptomics: RNA-seq analysis comparing wild-type and psiE deletion mutants under various stress conditions to identify genes co-regulated with psiE

  • Proteomics: Mass spectrometry-based identification of proteins differentially expressed in response to psiE modulation, with particular attention to phosphoproteomics if psiE is involved in signaling pathways

  • Metabolomics: Analysis of metabolic shifts associated with psiE expression or deletion to identify biochemical pathways affected

  • Network analysis: Integration of multi-omics data to construct regulatory and metabolic networks centered on psiE function

These approaches, combined with genetic manipulation techniques and phenotypic characterization, can place the psiE homolog within specific cellular processes and regulatory networks, advancing our understanding beyond isolated protein function to system-level impacts.

What are the most promising future research directions for studying psiE homolog in B. amyloliquefaciens?

Future research on the psiE homolog in B. amyloliquefaciens should prioritize:

  • Functional characterization: Determining the precise molecular function through biochemical assays, structural studies, and comparison with well-characterized psiE proteins from other bacteria

  • Regulatory network mapping: Identifying transcription factors and signaling pathways that control psiE expression, particularly in response to environmental stressors

  • Engineering applications: Exploring how modulation of psiE expression might enhance B. amyloliquefaciens as a protein production host, potentially by improving stress tolerance or nutrient utilization

  • Comparative analysis: Examining psiE homologs across diverse Bacillus species to understand evolutionary conservation and specialization

  • Applied research: Investigating potential biotechnological applications, such as biosensor development if psiE is confirmed to have sensing functions

These research directions build upon the established knowledge of B. amyloliquefaciens modular engineering and signaling systems , extending into the specific context of psiE homolog function and application.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.